Details for Capsella Locus Carubv10013508m

Position : scaf_3 ( 5`- 8681183 .. 8685101 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013508m

Protein [Map View]
LFTFTTKQNRLLLLLTQIQSPLKIYTMHTMVDPTPTADHEGEGGGGGKKTSRTYVKKLIDVGEAKTQIVYSLPMIFTNLF
YYGVPLTSVMFASHLGHLELAGATLANSWATVTGYAFMTGLSGALETLCGQGFGAKNYRMLGIHLQSSCIVSLVFSIFIT
ILWFFTEPVFLLLKQDPNISRQAALYMKYLTPGLFAYGFLQNILRFCQTQSIIMPLVVFSFFPLVINIGLTYVLVNLSGL
GFIGAPVATSISTWIGFVSLGTYVICSNKFKETWTGFSLESFRHVVLNLTLSIPSTAMVCLEYWVFEILVFLAGLMPNPE
ISTSLVAICVNTESISYMITYGLSAAASTRVSNELGAENVKGAKNATSVAVKLSLVLALCMVVAILTGHDAWVGLFSNSH
EIKEAFSSLKFFIAASITLDSIQGVLSGVARGCGWQRIVTVINLGTFYLIGMPISVICGFKLKLYAKGLWIGLICGMICQ
SSSLLLMTIFRRWTKLNAATV*

DNA
CTCTTCACATTCACAACTAAACAAAATCGTCTTCTCCTACTCCTAACACAAATCCAAAGTCCTTTGAAGATATATACAAT
GCACACAATGGTTGATCCTACGCCGACGGCTGATCATGAAGGTGAAGGAGGAGGAGGAGGAAAGAAAACATCAAGAACTT
ATGTTAAGAAACTGATTGACGTGGGAGAAGCAAAGACTCAGATTGTTTATTCTCTGCCAATGATATTCACCAATCTTTTC
TACTATGGTGTCCCTTTAACCTCGGTTATGTTTGCTTCTCATCTCGGCCATCTTGAACTTGCTGGTGCCACCCTTGCTAA
TTCTTGGGCTACCGTCACTGGTTATGCCTTCATGACAGGGTTAAGTGGAGCACTTGAGACATTGTGTGGACAAGGCTTTG
GTGCAAAAAACTATCGGATGTTGGGGATTCATCTACAATCATCTTGCATCGTCTCATTAGTTTTCAGCATCTTCATCACC
ATCTTATGGTTTTTCACTGAACCTGTTTTCTTACTACTCAAACAAGATCCTAACATCTCAAGACAAGCTGCACTCTATAT
GAAGTACCTAACCCCTGGCTTGTTTGCTTATGGGTTCTTACAAAACATTCTGAGGTTTTGCCAAACACAATCCATCATTA
TGCCGCTAGTCGTCTTCTCGTTTTTCCCCTTGGTGATTAATATCGGTCTTACGTATGTGCTGGTTAATTTATCTGGCCTT
GGATTCATTGGTGCTCCCGTCGCCACGTCTATATCAACGTGGATAGGTTTCGTTTCTCTGGGAACTTATGTGATTTGTTC
GAACAAGTTTAAGGAAACATGGACTGGGTTTTCTTTGGAATCATTTCGTCATGTTGTTCTAAACTTGACGTTAAGCATCC
CTTCTACGGCTATGGTGTGTTTGGAATATTGGGTGTTCGAGATTCTAGTGTTTTTGGCGGGATTGATGCCAAATCCAGAA
ATCAGCACCTCTTTGGTAGCTATATGCGTCAACACGGAATCGATCAGCTACATGATAACATACGGACTTAGTGCAGCTGC
AAGCACGCGTGTGTCCAACGAACTTGGAGCAGAAAATGTAAAAGGCGCAAAAAACGCGACTTCTGTAGCTGTTAAGTTGT
CTTTAGTCCTTGCTCTCTGCATGGTGGTTGCTATACTCACTGGTCATGATGCTTGGGTTGGTTTGTTCAGCAATAGCCAT
GAGATTAAAGAGGCGTTTTCATCATTGAAGTTTTTCATTGCTGCCTCTATAACTCTTGATTCAATCCAAGGTGTTTTATC
AGGAGTTGCAAGAGGATGCGGATGGCAGCGTATAGTTACGGTTATAAATTTGGGAACATTCTACCTAATTGGAATGCCTA
TTTCAGTAATTTGTGGTTTCAAGTTAAAGCTTTATGCCAAGGGTTTGTGGATTGGTCTGATATGTGGAATGATCTGCCAA
TCTTCATCTCTCTTGCTTATGACAATTTTCCGGAGATGGACAAAGCTAAATGCTGCTACTGTCTGA