Details for Capsella Locus Carubv10013506m

Position : scaf_3 ( 5`- 723125 .. 727351 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013506m

Protein [Map View]
MGFDPERQSISFAGQIGDSSSGGISAEKEPLIKENHSPENYSVLAAIPPFLFPALGALLFGYEIGATSCATISIKSPTLS
GISWYDLSSVDVGIMTSGSLYGALIGSMVAFSVADTIGRRKELILAAFVYLVGAIVTSVAPVFSVLIIGRVLYGIGIGLT
MHAAPMYIAETAPSQIRGRMISLKEFSTVLGMVGGYGIGSLWVTVISGWRYMYATILPVPVIMGIGMCWLPASPRWLLLR
ALQGKGNGENLQQAAIKSLRRLRGPAIADSAAEQVNEILAELSSVGEDKEATFADLFRGKCLKALTIAGGLVLFQQITGQ
PSVLYYAPSILQTAGFSAAADATRISILLGVLKLVMTGVSVIVIDRLGRRPLLLGGVSGMVVSLFLLGSYYIFYNTAPAV
AVAALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCGFGVICLLSLF
FIYFIVPETKGLTLEEIEAKCL*

DNA
ATGGGGTTTGATCCCGAGAGGCAATCGATCTCCTTCGCTGGACAGATTGGTGATTCTTCTTCAGGTGGGATTAGTGCTGA
AAAGGAACCTCTGATAAAGGAGAACCACAGCCCAGAAAACTACTCTGTTCTTGCAGCCATTCCTCCGTTTCTCTTTCCAG
CTCTTGGAGCTTTGCTTTTTGGTTATGAAATTGGTGCTACATCTTGTGCAACCATTTCTATTAAGTCGCCTACCCTAAGT
GGAATTTCATGGTACGACTTGTCTTCAGTGGATGTTGGTATAATGACTAGTGGCTCGCTGTATGGTGCCTTAATTGGCTC
CATGGTCGCATTTAGTGTTGCCGACACTATAGGAAGAAGAAAGGAGCTGATTTTGGCTGCATTCGTGTATCTTGTTGGAG
CCATTGTGACTTCAGTAGCACCTGTCTTTTCCGTACTGATAATTGGTCGAGTTTTGTATGGCATCGGGATTGGACTGACA
ATGCACGCGGCTCCAATGTACATTGCAGAGACTGCTCCAAGTCAGATACGTGGACGGATGATATCGCTAAAGGAATTCTC
CACTGTCCTTGGGATGGTTGGAGGTTACGGAATCGGTAGCCTTTGGGTTACGGTTATTTCTGGTTGGCGTTACATGTACG
CAACAATTCTCCCTGTGCCAGTTATTATGGGAATTGGAATGTGTTGGCTACCAGCTTCTCCTAGGTGGCTTTTATTGCGC
GCTCTCCAGGGAAAAGGTAATGGGGAGAATCTTCAACAGGCTGCAATTAAGTCTCTTCGGCGTCTAAGAGGCCCTGCCAT
AGCTGACTCAGCAGCTGAACAAGTAAACGAGATATTGGCTGAACTTTCCTCTGTGGGTGAGGACAAAGAAGCTACATTTG
CTGATTTATTTCGAGGCAAATGCTTGAAAGCTCTCACTATAGCAGGAGGGTTAGTCTTGTTCCAACAGATAACTGGACAA
CCAAGTGTACTTTATTATGCACCATCAATACTGCAGACTGCCGGCTTTTCTGCTGCAGCTGATGCAACTCGGATCTCAAT
TCTGCTTGGTGTATTGAAGTTGGTTATGACAGGAGTTTCTGTTATAGTGATTGACAGGCTTGGAAGGAGACCTTTACTTC
TTGGTGGTGTTAGTGGCATGGTGGTCTCATTGTTCCTCCTGGGGTCCTATTACATCTTTTATAATACTGCACCAGCTGTT
GCTGTAGCTGCGTTGCTACTCTATGTGGGCTGTTACCAGCTATCCTTTGGTCCTATTGGTTGGCTGATGATTTCGGAGAT
ATTTCCCTTAAAACTAAGAGGTCGAGGAATCAGTCTTGCAGTGCTTATTAATTTCGGTGCAAACGCACTTGTGACATTCG
CGTTCTCACCTCTTAAGGATCTGTTAGGAGCTGGAGTGTTGTTCTGTGGATTTGGAGTGATATGCCTACTGTCTCTCTTC
TTCATCTACTTCATTGTGCCTGAGACAAAGGGTCTCACTCTTGAAGAAATCGAAGCCAAATGTCTCTAA