Details for Capsella Locus Carubv10013499m

Position : scaf_3 ( 5`- 6288152 .. 6290777 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013499m

Protein [Map View]
MDPSLSISCDSHHHPPQFTPFPPFPASNPFGSGGAAAINPLGPNPYHPNNHIFQPQPQTQTQNPQPPMIPHPSLNHPPYS
EVCLWRSRFAALNEPDGSSKMAISRYIERCYTGLLPSAHPALLTHNLKTLKSSGVLAMVKKSYKFAVSSSPPESVAVAAA
AAAQGLDVPRSDILNSGYDPRAVSASGSASQPLKRGRGRPPKPKPEAQPQPLQAISGQSNGQPSWQQQQSGSPVPRPTEA
SPVPVTESAKRGPGRPRKNGAAASAGPIVQASVMAGIMKRRGRPPGRRAAGRQRKPKSVSATASVYPYVANGARRRGRPR
RVVDPSSVVAVAPAGGEIGAAVAPGMKRGRGRPPKIGGVISRLMKPKRGRGRPVGRPRKIATSVTTGTQDSGELKKKLDV
FQEKVKEIVKVLKDGVTSDNPAVVQAIKDLEGLTVMETVEPQAMDDVQPQPMETAAPHTESQIEAAETQGEQEQGQERDE
GEAQTQTQTQIQTEAEAMQEALF*

DNA
ATGGATCCATCTCTTTCCATTTCCTGTGATTCTCATCACCATCCTCCACAGTTCACCCCTTTCCCTCCTTTTCCCGCCTC
AAACCCTTTTGGCTCCGGCGGCGCCGCTGCTATTAATCCTTTGGGACCTAATCCTTATCACCCAAACAACCATATCTTCC
AACCGCAGCCGCAAACGCAAACGCAAAATCCCCAACCGCCGATGATTCCCCATCCTTCCCTCAACCACCCTCCTTACTCT
GAAGTATGTTTATGGCGCTCGCGATTTGCGGCGTTAAATGAACCCGACGGTTCGAGCAAGATGGCAATTTCGAGATACAT
CGAGAGATGCTACACCGGTTTACTCCCTTCTGCTCATCCTGCTTTGTTGACTCACAATCTCAAGACTTTGAAGAGCAGTG
GCGTTCTTGCTATGGTTAAGAAATCTTACAAATTCGCTGTTTCCTCTTCTCCTCCTGAGAGTGTTGCTGTTGCTGCCGCT
GCCGCCGCTCAAGGTCTCGATGTTCCCAGATCTGATATTCTCAACTCCGGCTATGATCCCAGGGCTGTCTCTGCTTCCGG
TTCTGCTTCTCAGCCTCTCAAACGAGGTCGTGGTCGTCCTCCCAAACCTAAACCTGAAGCTCAACCACAACCACTGCAAG
CCATCAGTGGTCAGTCTAACGGGCAGCCAAGCTGGCAACAACAGCAATCCGGATCACCTGTCCCGAGACCGACCGAAGCA
TCTCCGGTTCCGGTTACTGAGTCGGCTAAGAGAGGACCTGGTCGCCCAAGGAAGAACGGAGCTGCTGCTTCTGCTGGACC
AATCGTTCAGGCTTCGGTTATGGCTGGAATCATGAAACGTAGAGGGAGACCACCCGGTCGTAGAGCTGCTGGGAGACAGA
GGAAACCCAAGTCCGTCTCTGCTACTGCTTCTGTGTATCCGTATGTTGCTAATGGTGCTAGACGCAGGGGAAGGCCTAGG
AGAGTTGTTGACCCTAGCAGCGTCGTTGCCGTTGCTCCAGCAGGAGGTGAAATTGGGGCGGCTGTTGCGCCAGGGATGAA
GCGTGGACGAGGACGACCACCCAAGATTGGTGGTGTCATCAGTAGGCTTATGAAGCCTAAGAGAGGACGAGGACGTCCCG
TTGGTAGACCCAGAAAGATTGCAACATCAGTCACCACTGGGACACAAGATTCTGGAGAACTCAAGAAAAAGCTTGATGTT
TTTCAAGAGAAAGTAAAAGAAATCGTGAAGGTCTTGAAAGATGGAGTTACTAGTGACAATCCTGCAGTTGTGCAAGCCAT
AAAAGATCTGGAAGGACTAACAGTGATGGAGACGGTTGAGCCACAAGCCATGGATGATGTGCAGCCACAGCCAATGGAAA
CTGCAGCACCACACACTGAATCTCAAATTGAAGCTGCTGAAACTCAAGGAGAACAGGAACAGGGACAAGAAAGAGATGAA
GGGGAAGCACAGACCCAGACCCAGACCCAGATCCAGACAGAAGCAGAGGCGATGCAAGAAGCACTGTTCTGA