Details for Capsella Locus Carubv10013488m

Position : scaf_3 ( 5`- 8854390 .. 8856553 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013488m

Protein [Map View]
CLLPHHTHLSKNPHFQENKTSEMALLVEKTSSGREYKVKDMSQADFGRLEIELAEVEMPGLVSCRTEFGPSQPLKGARIT
GSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVFAWKGETLQEYWWCTERALDWGPGGGPDLIVD
DGGDATLLIHEGVKAEEIFAKNGTFPDPTSTDNPEFQIVLSIIKDGLQVDPKKYHKMKERLVGVSEETTTGVKRLYQMQE
TGTLLFPAINVNDSVTKSKFDNLYGCRHSLPDGLMRATDVMIAGKVAVICGYGDVGKGCAAAMKTAGARVIVTEIDPICA
LQALMEGLQVLTLEDVLSEADIFVTTTGNKDIIMVDHMRKMKNNAIVCNIGHFDNEIDMLGLETFPGVKRITIKPQTDRW
VFPDTKSGIIILAEGRLMNLGCATGHPSFVMSCSFTNQVIAQLELWNEKSSGKYEKKVYVLPKHLDEKVAALHLGKLGAR
LTKLSKDQSDYVSIPIEGPYKPVHYRY*

DNA
TGTCTCCTCCCACATCACACCCATCTCTCAAAGAATCCACATTTTCAAGAAAACAAAACTTCAGAGATGGCGTTGCTCGT
TGAGAAAACCTCAAGTGGCCGTGAGTACAAGGTCAAAGACATGTCTCAAGCCGACTTCGGCCGTCTCGAAATCGAGCTAG
CCGAAGTCGAAATGCCTGGACTCGTCTCTTGCCGTACCGAGTTCGGACCATCTCAGCCACTCAAAGGAGCAAGAATCACC
GGTTCACTCCACATGACGATCCAAACCGCCGTGTTGATCGAAACCTTAACCGCTCTTGGCGCTGAGGTGAGATGGTGTTC
TTGCAACATCTTCTCAACTCAAGACCACGCCGCAGCCGCCATTGCTCGTGATTCCGCCGCCGTGTTCGCTTGGAAAGGTG
AGACTCTTCAAGAGTACTGGTGGTGTACTGAGAGAGCTCTTGACTGGGGTCCTGGTGGTGGTCCTGATCTCATCGTTGAC
GACGGTGGTGATGCTACTTTGTTGATCCATGAGGGTGTTAAAGCTGAAGAGATCTTTGCCAAGAATGGTACGTTCCCTGA
CCCGACATCAACAGATAACCCCGAGTTTCAGATCGTGTTGTCCATTATCAAAGATGGTCTTCAAGTTGATCCTAAGAAGT
ACCATAAGATGAAGGAGAGATTGGTTGGTGTTTCTGAGGAGACTACCACTGGTGTTAAGAGGCTTTATCAGATGCAGGAG
ACTGGAACTCTCTTGTTCCCTGCCATTAACGTTAATGACTCTGTCACCAAGAGCAAGTTTGACAACTTGTATGGATGCCG
TCACTCTCTACCAGACGGTCTCATGAGGGCTACTGATGTTATGATTGCCGGAAAGGTCGCTGTTATCTGTGGTTATGGTG
ATGTTGGAAAAGGTTGTGCTGCAGCCATGAAAACAGCTGGTGCTCGTGTCATTGTGACTGAGATTGATCCAATCTGTGCC
CTTCAGGCTCTTATGGAAGGTCTTCAAGTTCTAACTCTTGAGGATGTTCTCTCAGAAGCTGATATCTTTGTCACCACAAC
TGGAAACAAAGATATTATTATGGTTGACCATATGAGGAAGATGAAGAACAATGCCATTGTTTGCAACATTGGTCATTTTG
ACAACGAAATCGACATGCTCGGGCTAGAGACCTTCCCTGGTGTGAAACGTATCACCATCAAGCCGCAGACTGATAGGTGG
GTGTTTCCAGACACCAAGTCTGGCATCATTATTCTAGCTGAAGGTCGTTTGATGAACTTGGGATGCGCCACTGGACACCC
GAGTTTCGTGATGTCGTGCTCGTTCACCAACCAGGTGATTGCACAGCTTGAGCTTTGGAATGAGAAGTCTAGCGGGAAGT
ACGAGAAGAAGGTGTATGTTTTGCCTAAGCACTTGGATGAGAAGGTAGCTGCACTTCATTTGGGCAAGCTAGGTGCCAGA
CTCACCAAGCTTAGCAAAGACCAATCTGACTATGTCAGCATACCCATTGAAGGTCCTTACAAGCCTGTTCACTACAGGTA
CTGA