Details for Capsella Locus Carubv10013485m

Position : scaf_3 ( 5`- 2531491 .. 2533395 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013485m

Protein [Map View]
MFLSPGHSPRQISSPSPSSYSDDTLRSAPRSSSSSEIVPRNPRKRMRVLDEDAYVEAIEKIIERDYFPDITKLRDRLDWI
QAVKTRDPIQIRDAQLKIIERRGKKASHHVGDTEGKTQTPGSTFLRNFTPFDEFDGKTPRTPGVSGREFPGSEVDVGDGD
GDIDLDLSLDEFFRRYTSEDNDSFSRILEKVNRRKKEKYGFLLEGEKEDGKLIEDVKRDRITDGYGTSDQPPSTLEGWKY
TAKNLLMYHPADRGEAPLTEAERAVRLLGLTKEIVKGNTRFHGKTMDSRPREDGSVEILYTPIAGSSPMHIPGRDRDKSK
RYDLDDLRKTPNPFYVESDKRADNGYSFVRTPSPAPGLDESPFITWGEIDGTPMRLDPEDTPIDIGGSADGPHYNIPSAP
PRDVRAHSLSRDASRKLRERSNSMFKKPPLPSPHRSGSASPNVRTLSPAAQKFFRRAIAKSSSTVDESLRASYRGASPRG
ASPGAVTPKSVRSVSRFGKDGTSSETRSP*

DNA
ATGTTTCTCTCGCCTGGTCATTCTCCGCGACAGATTTCTTCTCCATCTCCGTCGTCTTATTCCGATGATACCCTCAGGTC
GGCGCCTCGTAGTTCCTCTTCCTCGGAAATCGTCCCACGGAACCCTAGGAAACGAATGAGAGTTCTCGATGAGGACGCGT
ATGTTGAAGCAATCGAGAAGATCATCGAGCGCGATTACTTTCCAGATATAACCAAGCTTAGGGATCGGCTCGATTGGATC
CAGGCTGTGAAAACCCGTGACCCGATTCAAATCCGAGACGCCCAGTTGAAGATCATCGAGAGGCGTGGTAAGAAGGCGAG
TCATCATGTTGGGGACACCGAGGGTAAAACTCAAACTCCTGGATCTACTTTTTTGAGAAATTTCACTCCTTTTGATGAAT
TTGATGGTAAAACCCCTAGAACTCCTGGAGTCTCTGGTAGAGAATTTCCTGGTAGTGAAGTAGATGTTGGTGATGGAGAT
GGAGATATAGATCTTGATTTGTCCTTGGATGAGTTCTTTAGGAGATATACAAGTGAGGATAACGATAGCTTTTCGAGGAT
TCTTGAGAAGGTAAATAGGAGGAAGAAGGAGAAGTATGGTTTTCTCCTTGAAGGTGAAAAGGAGGATGGTAAATTGATTG
AGGATGTAAAGAGAGATAGAATTACAGATGGGTATGGTACATCTGATCAGCCACCGAGCACTTTAGAAGGATGGAAGTAT
ACAGCAAAAAATCTTCTCATGTACCATCCAGCTGATAGGGGAGAGGCGCCCTTAACCGAGGCTGAAAGGGCTGTTAGGTT
ACTTGGATTGACTAAGGAGATTGTTAAAGGGAACACTCGTTTTCATGGGAAGACTATGGATTCTAGGCCAAGAGAAGATG
GTTCAGTTGAGATTCTCTACACTCCAATCGCAGGTTCATCCCCAATGCATATTCCTGGTAGGGATAGAGACAAATCTAAG
AGGTATGATCTGGATGATCTAAGGAAAACCCCGAATCCCTTCTATGTGGAATCAGATAAAAGGGCAGATAATGGGTATAG
TTTTGTTAGAACGCCTTCTCCTGCCCCAGGTCTTGATGAGTCGCCCTTTATAACGTGGGGTGAGATTGATGGGACACCAA
TGCGCTTAGATCCCGAGGATACACCTATTGATATTGGTGGTAGTGCTGATGGACCGCACTACAACATTCCATCTGCACCT
CCCAGAGATGTAAGGGCACATTCATTATCAAGGGATGCATCACGAAAACTGAGAGAGAGATCAAACAGTATGTTTAAGAA
ACCTCCTTTGCCATCTCCTCATCGAAGTGGAAGTGCAAGTCCAAATGTTAGGACACTTTCACCCGCTGCTCAGAAGTTTT
TCAGACGGGCTATAGCTAAATCATCTTCTACGGTTGATGAGAGCCTTCGTGCAAGTTATCGTGGAGCCAGTCCACGTGGA
GCAAGTCCTGGTGCTGTGACTCCTAAGAGTGTGAGAAGTGTTTCACGATTTGGCAAAGATGGGACCAGCTCAGAGACAAG
GTCACCTTGA