Details for Capsella Locus Carubv10013484m

Position : scaf_3 ( 5`- 4323839 .. 4325673 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013484m

Protein [Map View]
MSKVGSSLFSRLHGIFKESSIGAVKSTKPKRQNKPSKFPSKLKASPSSSASVVDGGNEAKGSKLTKKVEKFKKSCESESF
RQVHGLYSAFIRRLREAKKFSTIDEVLQYQKKFDDIKSEDFVIRMMLLYGYSGMAEHAHKLFDEMPELNCERTVKSFNTL
LSAYVNSRKVDEAIKAFKQLPEKLGITPDLVTYNTMIKALCRKGSMDDIVSIFEELDKNGLEPDLITFNTLLEEFYRRDL
FVEGDRIWDLMKSKNLAPNIRTYNSRVRGLTRNKKFTDAINLMDVMKTEGIFPDVHTYNAFITAYRIDNNLEEVMKWYNE
IKDQGLTPDTVTYCLLIPLLCKKGDLDRAVEISEEAIKHKVLSRPNMYRPVVERLLGVGKLDKATQLVKNGKLQSYFRYL
PDVSAGKKKTTSSPISSSPETSSSSVSLSSETILLSLSLETSSSPDSSSSVSSSADTSSSVSSSLDSSSLYSSSSDSFSP
ASSSLYSSSSDSSSANSSSSVSSSGLLDD*

DNA
ATGAGCAAGGTGGGCTCATCGCTGTTCAGTCGCCTCCATGGAATCTTCAAAGAGTCTTCGATCGGCGCCGTCAAGTCCAC
TAAACCTAAACGCCAAAACAAACCCAGTAAATTCCCTAGTAAATTGAAGGCCTCCCCCTCATCTTCCGCCTCCGTAGTAG
ACGGAGGGAATGAGGCCAAGGGATCGAAACTGACGAAGAAAGTAGAGAAGTTCAAGAAATCCTGCGAGTCAGAGAGTTTC
CGGCAAGTCCATGGACTCTACAGTGCCTTTATCCGCCGTCTCAGGGAAGCGAAGAAGTTCTCAACGATCGACGAAGTTCT
TCAGTACCAGAAGAAGTTCGATGATATCAAGTCTGAAGATTTCGTTATCCGTATGATGCTTCTTTATGGATACTCTGGAA
TGGCGGAGCATGCGCACAAGTTGTTCGATGAAATGCCTGAGCTAAACTGTGAACGAACTGTCAAGTCGTTCAATACCCTT
TTATCGGCTTATGTTAATTCGAGGAAGGTTGATGAAGCCATCAAGGCCTTCAAGCAGTTGCCAGAGAAGCTAGGTATTAC
CCCTGATTTGGTTACTTATAATACTATGATCAAAGCACTTTGCCGCAAAGGCTCTATGGATGATATAGTATCCATATTTG
AGGAGCTGGACAAGAATGGGCTTGAGCCTGACCTGATTACTTTCAACACACTGTTAGAAGAGTTCTATAGGAGGGATTTG
TTTGTTGAAGGAGATAGGATTTGGGATTTGATGAAATCCAAGAATCTTGCTCCTAACATCAGGACTTATAACTCGAGGGT
GAGAGGTCTAACTCGGAACAAGAAGTTCACTGATGCAATTAACTTGATGGATGTTATGAAAACTGAAGGGATCTTCCCAG
ATGTTCATACATACAATGCTTTCATTACGGCTTACCGCATTGATAACAACCTAGAGGAGGTTATGAAATGGTACAATGAG
ATTAAGGATCAGGGTCTGACTCCTGATACAGTTACTTACTGTTTGTTAATCCCCCTTCTCTGCAAGAAAGGTGATCTAGA
TAGAGCTGTTGAGATATCCGAAGAAGCCATCAAACACAAGGTTCTGTCTCGCCCCAACATGTACAGACCCGTGGTTGAGC
GTTTGCTGGGTGTAGGCAAGCTTGATAAAGCAACACAGCTAGTGAAGAATGGCAAGTTACAGAGTTACTTTCGGTACCTA
CCAGACGTGTCAGCTGGTAAGAAGAAGACCACTTCCAGTCCGATCTCTTCAAGTCCGGAGACCTCTTCGAGTTCGGTCTC
TCTAAGTTCAGAGACCATTCTGCTCTCTTTAAGTCTGGAGACTTCTTCAAGTCCGGACTCTTCGAGCTCAGTCTCTTCCA
GCGCGGACACTTCGAGCTCTGTCTCTTCCAGCCTGGACTCTTCGAGTCTGTACTCTTCCAGCTCGGACTCTTTCAGCCCG
GCCTCTTCAAGTCTGTACTCTTCCAGCTCGGACTCTTCGAGTGCGAACTCTTCCAGCTCAGTCTCTTCGTCTGGCTTGTT
GGACGATTAA