Details for Capsella Locus Carubv10013460m

Position : scaf_3 ( 5`- 1825436 .. 1828595 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013460m

Protein [Map View]
MSPLRLFILLLAVFSLLSSSLSQPSPPSAILIDCGASDSSVIDGRQWQSDEDFVSSGTPKNVADKVLDEILFTVRSFPSN
LDGTRRKFCYVVSVSRGWKYMIRTTYFYGGVNGKGTPPPVFDQIVDGTFWGIVNTTADYADGLASYYEGVFMAQGKSISV
CIASNSYTTSDPFISALELVRLDATLYNSTDFTTVGMSLVARHAFGYSGPIIRFPDDQFDRFWEPYSLNSTVPNNRKLEV
SGFWNLPPARIFNTDLRATQVQPLEFTWPPMPLTKATYYIALYFAHDSDSLGDGSRVFDVSVNGITYYKELSVTPAGVVI
FASRWPLEGLTTLSLSPRSGSNLSPLINGGEMFELVPLGGKTLVRDMTAMNAIKNSFEDAPADWNGDPCFPKNYSWSGVT
CSEGPRIRIVTLNLTNMGVSGSLAPALSKLTALSSIWLGNNSLSGSLPDISSLKRLESLHLEDNRFSGNIPPSLGGVPHL
RELFLQNNNLTGQIPSNLLQKPGLNLRTSGNPFLTQPTR*

DNA
ATGTCCCCTCTCCGCCTCTTTATCCTCCTCCTCGCCGTCTTCTCTCTTCTCTCTTCCTCCCTCTCTCAGCCTTCTCCTCC
CTCAGCGATTTTGATCGATTGTGGCGCCTCTGATTCATCGGTAATTGACGGCCGACAATGGCAATCCGACGAGGATTTCG
TCTCCAGCGGAACACCGAAGAACGTCGCAGATAAAGTGCTCGACGAAATTCTGTTCACCGTCAGATCCTTCCCTAGTAAC
CTCGACGGAACTCGTCGCAAGTTTTGCTACGTGGTGAGCGTTTCTCGCGGCTGGAAGTATATGATCAGGACTACTTATTT
CTACGGCGGGGTTAACGGAAAAGGTACTCCGCCGCCGGTGTTTGATCAGATTGTCGACGGCACGTTTTGGGGGATCGTCA
ATACCACAGCGGATTACGCCGATGGTCTCGCCTCTTATTACGAAGGGGTTTTTATGGCGCAGGGGAAATCTATTAGCGTC
TGCATTGCTTCTAATTCTTATACCACTTCTGATCCATTTATCTCAGCCTTGGAGCTCGTCAGGCTTGATGCTACTCTTTA
CAATTCCACTGACTTCACCACTGTTGGGATGAGTCTTGTTGCTAGGCATGCCTTTGGATACAGTGGACCAATCATCAGGT
TTCCGGATGATCAGTTTGATAGGTTCTGGGAGCCTTATTCGCTGAATTCGACTGTACCAAACAATAGGAAACTTGAGGTT
TCTGGTTTCTGGAACCTTCCGCCTGCGAGGATATTCAATACAGATCTAAGAGCTACCCAAGTTCAGCCTTTGGAGTTCAC
ATGGCCCCCAATGCCCTTAACGAAAGCCACTTACTATATTGCGCTATACTTTGCTCATGATTCTGACTCTTTGGGAGATG
GATCCAGAGTCTTTGATGTTTCTGTCAATGGTATAACATATTATAAAGAGCTGTCTGTCACTCCAGCTGGTGTGGTTATC
TTTGCAAGCAGGTGGCCTCTTGAAGGTCTCACAACGTTATCTCTAAGTCCTAGAAGTGGTTCAAACCTTTCCCCCCTTAT
CAATGGTGGTGAAATGTTTGAGTTGGTGCCTCTTGGAGGCAAAACTCTTGTTCGAGATATGACTGCTATGAATGCAATTA
AAAACAGTTTCGAGGATGCACCAGCTGATTGGAATGGGGATCCTTGTTTCCCCAAAAATTACTCTTGGTCTGGTGTTACC
TGCTCGGAAGGCCCCCGAATTCGCATAGTCACCTTGAACTTAACTAATATGGGCGTTTCAGGTTCCCTAGCACCTGCGCT
TTCCAAATTAACAGCATTGTCCTCCATTTGGCTAGGAAACAATTCTCTGTCGGGAAGTTTACCTGACATCAGTTCACTCA
AACGGCTGGAATCACTGCATTTGGAAGACAATCGTTTCAGTGGAAATATTCCTCCATCTCTAGGTGGAGTGCCGCACTTG
CGAGAGCTATTCTTGCAAAACAACAACCTTACTGGCCAAATTCCAAGCAATCTTCTTCAGAAGCCTGGACTGAACCTAAG
GACTTCTGGTAACCCCTTTTTGACTCAACCAACACGTTAA