Details for Capsella Locus Carubv10013436m

Position : scaf_3 ( 5`- 7548351 .. 7554361 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013436m

Protein [Map View]
MSSTYKFNNTDPFGNGDAKSFCPSPVNGFSDSISQSEKAVQELLLQQSPMQATDDHLIEFSEALRTVAKALRGAAEGKAL
AQAEAAEWKRRYELERSKNAELQQKGSLLTQKELPNGVFADESKSPRMEHIAKSPRLYAHENSSNGLESICSHEVLQDGG
FNSSNNKLKRKASFKLSWRCKGMANDQHKKEIVSFERGNISTAERSSKQISLTWESDPQTVLIITKPNSTSVQVLSVDMI
RWLRTQKGLNIYVEPRVKAELLSESSSFNFVQTWEDDKEISLLHTKVDLLITLGGDGTVLWAASMFKGPVPPIVPFSMGS
LGFMTPFHSEQYRECLEAVLKGPISITLRHRLQCHIIRDKARHEYETEETMLVLNEVTIDRGISSYLTNLECYCDDSFVT
CVQGDGLILSTTSGSTAYSLAAGGSMVHPQVPGILFTPICPHSLSFRPLILPEHVTVRVQVPFNSRSSAWVSFDGKDRKQ
LEAGDALVCSMAPWPVSTACQVESTNDFLRSIHDGLHWNLRKTQSTDGPQDT*

DNA
ATGTCGTCGACCTACAAGTTCAATAACACTGATCCTTTTGGAAATGGAGATGCAAAGAGTTTTTGCCCGAGCCCAGTGAA
TGGTTTTAGTGATTCAATTTCTCAATCAGAGAAGGCTGTTCAGGAGCTACTTCTTCAACAGTCTCCTATGCAGGCAACCG
ACGACCATCTCATTGAGTTTTCTGAGGCTTTGAGAACTGTTGCAAAGGCACTAAGGGGCGCTGCTGAAGGAAAGGCGTTG
GCTCAAGCAGAGGCTGCTGAATGGAAGCGTAGATACGAGTTAGAGAGGTCGAAAAACGCGGAGTTGCAGCAGAAAGGTTC
TCTTCTAACTCAAAAAGAACTACCTAACGGAGTGTTTGCCGATGAATCTAAAAGTCCAAGGATGGAGCACATAGCAAAGT
CTCCGCGGCTTTATGCTCACGAAAACAGTTCTAATGGCTTGGAGAGTATTTGCTCGCATGAAGTGCTCCAAGATGGTGGA
TTTAATAGTTCTAATAACAAATTGAAGAGGAAGGCATCATTTAAACTTTCATGGAGATGTAAGGGGATGGCTAATGATCA
ACACAAAAAAGAAATTGTTTCGTTTGAGAGAGGAAATATCAGTACAGCAGAGCGCAGTAGTAAACAGATTTCACTGACAT
GGGAGTCTGATCCACAGACTGTGCTTATTATCACTAAACCGAATTCAACTTCCGTGCAAGTTCTCTCTGTGGATATGATC
AGATGGTTGAGAACGCAAAAAGGACTAAATATTTATGTGGAACCACGAGTAAAAGCGGAACTCTTGTCAGAATCAAGTTC
CTTTAACTTTGTACAAACTTGGGAAGATGACAAGGAGATTTCGCTTCTGCACACAAAGGTTGATCTTCTTATAACTCTTG
GTGGAGATGGAACAGTGTTATGGGCAGCATCAATGTTTAAAGGGCCAGTGCCTCCAATTGTTCCATTTTCCATGGGATCT
CTTGGATTCATGACTCCTTTCCACAGTGAACAATACCGAGAATGCCTTGAAGCGGTTTTGAAGGGTCCAATCAGTATAAC
ACTACGACACAGGTTGCAGTGTCACATCATCAGAGATAAAGCACGGCATGAATATGAAACAGAGGAGACTATGCTTGTTC
TGAATGAAGTCACCATTGACCGTGGAATATCTTCTTACCTCACAAACCTTGAATGTTACTGCGATGACTCATTTGTCACA
TGTGTGCAAGGCGATGGACTAATATTGTCTACAACATCTGGTAGCACTGCATATTCACTTGCAGCTGGAGGTTCAATGGT
CCATCCACAGGTGCCTGGAATCTTATTCACGCCAATCTGTCCTCATTCTCTATCATTCCGCCCATTGATATTACCGGAAC
ACGTGACAGTGAGAGTGCAAGTGCCATTCAATAGCAGAAGCTCTGCTTGGGTCTCCTTTGATGGGAAAGACCGGAAACAG
CTTGAAGCAGGGGATGCACTTGTGTGTAGCATGGCACCATGGCCCGTCTCAACCGCTTGCCAAGTTGAATCCACCAACGA
CTTCTTGCGTAGCATCCACGATGGTCTTCACTGGAACCTAAGAAAGACTCAATCTACTGATGGCCCTCAGGACACTTAG