Details for Capsella Locus Carubv10013427m

Position : scaf_3 ( 5`- 3538984 .. 3541217 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013427m

Protein [Map View]
RNFYSQLPSLGLMANPAEELDVNPPIREPEEEEVVEELNGDEEGEEEEEEEDNEGEDDDTESKSQTRKGRSSADRINAES
LFRRMRAAPVPVRVHDVIVRGNQKTKDHIIEAELEAAREATTLQELLEASRVANSNLRALDIFDSVNITLDSGPPELPGT
TNVVIEVVESKSPLTGQIGVYTRAEARSSSLEASLKYKNIFGYGDIWDGSIVHGYDNSAEVGLGMYLPRFRGFSTPFTSR
LYLSTQDWLKFSSYKERSLGLSLGLLSSKYHELVYTIAWRNLIDPSQAASASIRRQLGHTFLSALKYTFKFDQRNSYLRP
TNGYAFVSTSQIGGLAPDSRSLRFLKQEIDLRYAVPFGFYNTALNFGVSGGVSFPWGSGYQNRPSSVPERFFLGGNSSPL
CSLGGPSALWGFKTRGLGPNEPRRKGDSERDFVGGDAAVTAFADLSFDLPVRWLRERGIHGHVFASVGNMAKLSENEFRN
FSAPKFLETVRTSVGAGIVLPTSVFRMELNYCHVLKKQEHDQARSGVCVTFSASS*

DNA
CGAAATTTCTACTCTCAGTTGCCATCTCTCGGTCTCATGGCGAATCCGGCGGAAGAACTTGACGTGAATCCACCAATCCG
AGAACCCGAAGAAGAAGAAGTAGTTGAAGAACTTAACGGAGATGAAGAAGGAGAAGAAGAAGAAGAGGAGGAGGATAACG
AAGGAGAAGACGATGACACCGAGTCGAAATCTCAAACGCGCAAAGGCCGATCCAGTGCAGACAGGATCAACGCGGAATCT
CTTTTCCGTCGGATGCGAGCTGCTCCTGTGCCGGTGCGTGTTCACGACGTGATTGTCAGAGGAAACCAGAAGACCAAGGA
CCATATCATCGAGGCGGAATTGGAAGCTGCCAGAGAGGCGACCACGTTGCAGGAGCTTCTCGAAGCTTCTAGGGTTGCTA
ATTCGAATCTCCGAGCGTTAGATATCTTTGATTCCGTCAACATTACGCTCGATTCTGGTCCTCCTGAGCTTCCTGGTACC
ACCAATGTGGTAATTGAAGTTGTCGAGAGCAAAAGCCCTCTCACCGGCCAAATTGGCGTCTACACTAGAGCTGAGGCTAG
ATCATCAAGCCTTGAAGCTTCTTTGAAGTATAAGAACATTTTTGGCTATGGAGATATATGGGACGGGTCTATAGTTCATG
GCTATGACAACTCCGCTGAGGTTGGCTTGGGAATGTATCTGCCAAGGTTCAGAGGATTTTCTACTCCTTTTACTTCTCGC
CTTTACCTTTCGACTCAAGATTGGCTTAAGTTTTCATCGTATAAAGAACGATCCCTCGGTCTTTCTCTCGGTCTTCTCTC
AAGCAAGTATCATGAGCTCGTTTACACGATTGCGTGGCGTAATCTGATAGATCCATCCCAAGCAGCTTCAGCATCAATAA
GGAGGCAACTGGGACACACTTTTCTTTCTGCATTGAAGTATACTTTTAAATTTGACCAGAGAAACTCATACTTGAGGCCA
ACTAATGGATATGCTTTCGTCTCTACTTCTCAAATTGGTGGTCTTGCTCCTGATAGCCGTAGCTTACGCTTTTTGAAGCA
GGAAATTGATCTTCGATATGCTGTTCCGTTCGGGTTTTACAACACTGCTCTAAACTTTGGTGTGTCTGGGGGTGTCTCTT
TTCCATGGGGAAGCGGATACCAGAACCGACCTTCCTCTGTGCCAGAGAGATTCTTCTTGGGTGGCAATTCATCGCCTCTA
TGCTCTTTGGGTGGGCCATCCGCACTATGGGGATTCAAGACCAGAGGACTTGGTCCCAACGAGCCAAGGAGGAAAGGCGA
TAGTGAACGGGATTTTGTGGGAGGAGATGCTGCGGTGACTGCATTTGCGGATCTCTCATTTGATTTGCCAGTGAGATGGT
TAAGAGAGAGAGGAATCCACGGGCATGTGTTTGCATCTGTGGGGAATATGGCAAAGTTATCAGAGAATGAGTTTAGGAAC
TTCAGTGCTCCAAAGTTCTTGGAGACAGTCAGAACTTCAGTTGGTGCTGGAATCGTCTTACCAACTAGTGTATTCCGTAT
GGAGCTTAACTACTGCCATGTATTGAAGAAACAAGAACATGATCAAGCGAGATCAGGGGTCTGTGTGACATTCTCTGCCT
CATCCTGA