Details for Capsella Locus Carubv10013410m

Position : scaf_3 ( 5`- 3878766 .. 3881149 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013410m

Protein [Map View]
MDPPVTDLESIEDQKEGGPSFHCDLYDTEVVHKIAQVFLPGLATACVDNTTGDIFRSPGSVAADIRKEMIDYMNRRSESF
VAEHIVLQGGSEIEASHDPFDIISDFIDDFATSKRNLFSRVSGWMLSERREDNIDDFAQEMEISGFWLTDHREEIAQTLL
RNVDFKSSSHCEMKFQSQGELAEHAMSCGYRTMNCENEGCTAVFCANQMENHDSVCPFKIIPCEQNCSESIMRREMDRHC
ITVCPMKLVNCPFHAVGCLSDVHQCELQQHHLDNVSSHLMYILRSIYKEASPDDLKPRAEQIQQLSTQLSEARNARSLTN
LVKEIDAKLGPLEIKPKNFTNSESDKPENTITKALEEAEIKEKPETNLKDESLEQTAREDAMVDEAVKKVSEAEIADNVN
EEGELKAQKLLEIGEFIKEGDNNSVDDLLERTETKAPEVVVMDEDREDEESAEKNDSRTNESSKGFEVEVNAMNDEENSE
TKKSTETDTEAPSRIVMDKEEDEETMKSKARASDEAEALSKSSQGFSTAQAETVPNMS*

DNA
ATGGATCCTCCTGTGACGGATCTTGAGAGCATCGAGGATCAGAAAGAAGGAGGACCTTCCTTTCACTGTGATCTTTACGA
TACAGAAGTGGTTCACAAGATTGCTCAGGTCTTTCTCCCTGGATTAGCCACTGCTTGTGTCGATAACACTACCGGAGATA
TCTTCAGGAGTCCAGGTTCTGTGGCTGCTGACATTCGAAAAGAGATGATTGATTATATGAATCGCAGAAGCGAAAGCTTC
GTGGCTGAACACATTGTTCTTCAAGGTGGTTCGGAGATCGAAGCTTCTCATGATCCTTTTGACATCATTTCTGATTTCAT
CGATGATTTCGCCACTTCTAAGCGCAATCTTTTCAGCCGGGTTTCGGGTTGGATGCTTAGCGAGAGGAGAGAAGATAATA
TTGATGATTTCGCGCAAGAGATGGAGATAAGCGGGTTCTGGTTGACCGATCATAGAGAAGAGATCGCTCAGACTTTGCTT
AGAAACGTCGATTTTAAAAGCAGCTCTCATTGTGAGATGAAATTCCAAAGCCAAGGAGAACTCGCCGAGCACGCCATGAG
TTGTGGGTATAGAACAATGAACTGTGAGAATGAGGGTTGTACTGCGGTCTTCTGCGCAAATCAGATGGAGAATCACGATT
CTGTTTGCCCGTTCAAGATCATTCCGTGTGAGCAAAACTGCTCAGAAAGTATAATGAGACGCGAAATGGATCGGCATTGT
ATAACCGTATGTCCTATGAAACTTGTCAACTGTCCATTTCATGCTGTTGGTTGTCTCTCTGATGTACATCAGTGTGAGCT
CCAACAACATCATTTGGATAATGTAAGCTCTCATTTGATGTACATTCTCCGGAGTATCTACAAAGAAGCCTCTCCGGATG
ATCTTAAACCCCGAGCTGAACAGATACAGCAGTTGTCGACTCAGTTATCTGAAGCCCGGAATGCTAGATCACTAACGAAT
CTGGTCAAGGAAATTGATGCAAAGCTGGGGCCTTTAGAAATCAAACCAAAGAATTTTACTAACTCTGAGTCTGATAAACC
TGAAAATACAATAACGAAAGCTTTAGAAGAAGCTGAGATCAAAGAAAAACCGGAGACGAACTTAAAAGACGAGTCTTTGG
AGCAAACCGCAAGGGAAGATGCAATGGTGGATGAAGCTGTAAAGAAAGTTTCAGAAGCTGAGATAGCAGACAATGTTAAT
GAAGAAGGCGAATTAAAAGCTCAAAAGCTTTTAGAAATAGGCGAGTTCATCAAAGAAGGAGACAACAACTCTGTAGATGA
TTTGTTAGAGAGAACTGAAACCAAAGCTCCAGAAGTTGTGGTCATGGATGAAGATAGAGAGGATGAGGAGAGTGCAGAAA
AAAATGATTCGAGGACAAATGAATCAAGCAAAGGATTTGAGGTTGAAGTCAATGCCATGAATGATGAAGAGAATAGCGAG
ACAAAGAAATCAACTGAAACTGATACAGAAGCTCCATCGAGAATAGTCATGGACAAGGAGGAGGATGAAGAGACAATGAA
ATCAAAAGCTCGTGCTTCTGATGAAGCTGAAGCTCTGTCAAAGAGCTCTCAAGGTTTTTCGACAGCACAGGCTGAAACTG
TACCCAATATGTCTTAA