Details for Capsella Locus Carubv10013408m

Position : scaf_3 ( 5`- 4014166 .. 4019640 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013408m

Protein [Map View]
KPSGSKNLSLHNGETQRVGVAVLSLSLSVFHSLTMAFWGVEVKPSKTFTLKANEATGIRRLHLSQATLGHGNGTNRSILQ
CIVGNKSPLFLCVLTPDKVDSCQLNLEFEEADEVIFSVIGPRSVHITGYFLGRSTSFRSNDDESESYGEDIVDTDMEKGS
SDDYDYSDSFINDDDPPGRGSHMSSTDDDEISIKEMAAKTKDKKDNGKHGRLRKKFQVSDSDSDETSARADDSSNEDSIG
NEHKISKVLSSESPLPSRVTRSKAKSSTLVNGEPNAKCKKTSEERTHTNKNLDERVDDKPLSDVKFSPVQKGCDILSKKK
RKKERSKSSAIINLDDGEGENIPESLQNEKPDTEKGIKSSSNVSPSPNGDATLSKKKRKRDRREETTDVQENPFECLGKK
KQAIDKNIEKEAGIKEPLEMGTSSNGVIIEEIEKGKLDGKSAVKGKKVSILYTGTLKDTGKVFDSNLGEAPLRFRLGGEK
VIEGLSIGVEGMRFGDKRRLIIPPSLGYGKDSHSEEGFKEQVPKNAWLVYEVEAVKIR*

DNA
AAACCCTCAGGCAGCAAAAACCTCTCGTTACACAACGGAGAAACCCAAAGGGTCGGCGTTGCAGTCTTGTCTCTCTCTCT
CTCTGTCTTTCACTCTTTGACCATGGCTTTCTGGGGAGTTGAAGTGAAACCATCAAAAACTTTCACTCTTAAGGCTAATG
AAGCAACAGGAATCAGAAGACTTCACCTTTCCCAGGCGACACTGGGGCATGGTAATGGAACAAACAGAAGCATTCTTCAG
TGTATCGTTGGGAACAAAAGTCCCCTCTTCTTATGCGTCTTGACTCCTGACAAGGTTGATTCTTGCCAACTGAATCTGGA
GTTTGAAGAAGCTGATGAAGTCATCTTCTCTGTCATCGGACCTCGGAGTGTTCACATCACTGGCTACTTCCTCGGCAGGA
GTACCAGTTTTAGGTCAAATGATGATGAATCGGAGTCATATGGAGAAGACATTGTGGACACAGACATGGAGAAAGGTAGC
AGTGATGATTATGACTACAGTGATAGTTTCATAAACGACGACGATCCCCCTGGCCGTGGTTCACACATGTCTAGTACTGA
TGATGATGAAATATCTATTAAGGAGATGGCAGCTAAAACGAAAGACAAGAAAGATAATGGTAAACATGGAAGACTAAGGA
AGAAGTTTCAGGTCTCTGATTCAGATTCTGATGAAACATCTGCTAGAGCTGATGATTCGAGCAATGAAGATTCTATAGGT
AATGAGCACAAGATCTCGAAGGTCCTTTCTTCAGAGAGTCCTCTGCCTTCAAGGGTTACAAGGTCAAAGGCAAAAAGTTC
GACTTTGGTAAATGGTGAGCCAAATGCCAAGTGTAAGAAGACATCAGAAGAGAGAACTCATACTAACAAGAATTTAGATG
AAAGGGTGGATGATAAACCATTGAGTGATGTTAAATTCTCTCCCGTTCAGAAAGGGTGTGATATTCTTTCGAAGAAAAAA
AGAAAAAAGGAAAGGTCTAAGAGCTCAGCTATAATTAACTTAGATGACGGAGAGGGGGAAAATATACCTGAAAGTCTTCA
GAATGAGAAGCCAGATACTGAAAAGGGGATCAAATCATCAAGTAATGTATCACCCTCTCCGAATGGTGATGCAACTCTGT
CAAAGAAAAAGAGGAAAAGGGATAGGAGAGAGGAAACTACAGATGTCCAGGAAAATCCATTTGAATGTTTAGGAAAAAAG
AAACAAGCTATTGACAAGAATATCGAGAAAGAAGCTGGTATTAAGGAACCACTAGAAATGGGGACTTCATCAAATGGAGT
GATCATTGAAGAGATTGAAAAAGGAAAGTTAGATGGAAAATCAGCTGTTAAAGGGAAAAAGGTGAGTATACTCTATACTG
GGACTTTGAAAGACACCGGGAAAGTATTTGATTCAAACTTGGGAGAAGCTCCACTAAGATTCCGCTTAGGTGGAGAAAAG
GTCATAGAAGGTCTCAGTATTGGTGTTGAAGGTATGCGATTTGGTGATAAAAGAAGACTCATAATTCCGCCATCCCTCGG
ATATGGTAAAGACAGTCACTCAGAAGAGGGTTTTAAGGAACAGGTGCCTAAGAATGCTTGGCTTGTCTATGAGGTGGAGG
CGGTAAAAATCAGATGA