Details for Capsella Locus Carubv10013404m

Position : scaf_3 ( 5`- 3008851 .. 3012106 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013404m

Protein [Map View]
MEKSSYFLFGGTNFNKKKFAPDFAKFKNCPEDDDSSKKVSLFEEEEDTEQQEKKVVVSSKKRKRRSSNTVPVEGFDVFKS
SKKARGEGKEEDENTKNGILENPKKELNRRMERDALSRKQYNIHVSGNNIPPPLKSFAELSSRYSCKRYILRNLAELGFK
EPTPIQRQAIPVLLSGRECFACAPTGSGKTFAFICPMVIKLKRPSTDGIRAIILSPARELAAQTAREGKKLIKGSKFRIR
LMTKPLVKTADFSKLHCDVLISTPMRLKRAIKAKKIDLSKVEYLVLDESDKLFEQSLLKQIDCVVKACSNPSIIRSLFSA
TLPDSVEELARSIMHDAVRVIIGRKNTASETVKQKLVFAGTEEGKLLALRQSFAESLNPPVLIFVQSKERAKELYDELKC
ENVRVGVIHSDLPSGERENAVDHFRAGETWVLIATDVIARGMDFKGINCVINYDFPDSASAYIHRIGRSGRAGRSGEAIT
FYTEEDVPFLRNIANTMISSGCEVPSWIMSLKKKKWKKHRPRRDSISTRPKDDKKEEDE*

DNA
ATGGAGAAAAGCTCTTATTTTCTGTTTGGTGGAACAAACTTCAATAAGAAAAAGTTTGCTCCAGATTTTGCTAAGTTTAA
GAATTGTCCGGAGGATGATGATTCCAGTAAGAAAGTGAGCTTATTTGAGGAAGAAGAGGACACTGAACAGCAGGAGAAGA
AAGTTGTTGTTTCTTCTAAGAAGAGGAAACGAAGATCTTCCAATACTGTGCCGGTTGAAGGATTTGATGTGTTCAAGAGC
TCAAAGAAGGCACGTGGTGAAGGTAAAGAAGAAGATGAAAACACAAAGAATGGAATTTTAGAGAATCCGAAGAAGGAACT
TAATCGGCGAATGGAGCGTGATGCTCTGTCGAGGAAACAGTACAACATTCATGTTTCCGGTAACAATATTCCACCCCCGC
TTAAAAGCTTTGCAGAGTTGTCATCAAGATATAGCTGTAAACGATACATTTTACGCAATTTGGCTGAACTAGGATTTAAA
GAGCCCACCCCTATCCAAAGACAGGCTATTCCAGTTCTCCTATCGGGTCGTGAATGCTTTGCCTGTGCTCCGACTGGGTC
AGGAAAAACCTTTGCTTTTATTTGTCCCATGGTTATAAAACTCAAGCGCCCTTCAACAGATGGAATAAGAGCAATTATCC
TATCTCCTGCTCGGGAACTGGCTGCCCAAACAGCTAGAGAAGGAAAGAAACTTATTAAAGGAAGCAAGTTCCGCATTAGA
TTGATGACTAAACCCCTTGTGAAAACAGCTGATTTCTCAAAGCTGCATTGTGATGTTCTCATATCAACCCCGATGCGGCT
GAAGAGAGCCATCAAGGCTAAAAAAATTGACTTAAGCAAGGTCGAGTACCTTGTCCTTGATGAATCTGATAAGCTGTTTG
AGCAGAGCTTGTTAAAGCAGATAGATTGTGTGGTTAAGGCTTGTTCAAATCCTTCAATCATACGCTCATTGTTCAGTGCT
ACTTTACCCGATTCTGTTGAGGAACTCGCACGTTCCATAATGCATGATGCTGTTCGTGTGATCATTGGCCGAAAGAACAC
AGCGTCTGAAACCGTCAAACAAAAGCTGGTTTTTGCTGGAACTGAAGAAGGGAAACTCCTTGCTCTTCGCCAAAGCTTTG
CAGAGAGTCTGAATCCACCGGTACTGATATTTGTACAAAGCAAAGAACGAGCAAAGGAACTCTACGATGAACTGAAATGT
GAAAATGTCAGAGTCGGGGTCATCCATTCTGATCTCCCTTCAGGAGAGCGGGAGAATGCGGTTGATCATTTCAGAGCGGG
CGAAACATGGGTTTTGATTGCCACGGATGTGATCGCCAGAGGTATGGATTTCAAAGGCATCAATTGCGTGATAAACTATG
ATTTCCCAGACTCAGCTTCTGCATACATCCACAGGATTGGTCGGTCTGGAAGAGCAGGAAGGAGCGGAGAAGCGATAACA
TTCTACACAGAAGAAGATGTGCCTTTCCTAAGGAACATAGCCAACACGATGATATCATCGGGCTGTGAGGTTCCGTCGTG
GATCATGTCTTTGAAGAAGAAGAAGTGGAAGAAGCATAGGCCGAGACGTGATTCTATATCTACTCGACCAAAAGACGATA
AAAAGGAAGAAGATGAGTAA