Details for Capsella Locus Carubv10013396m

Position : scaf_3 ( 5`- 2066774 .. 2070642 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013396m

Protein [Map View]
MAISSPLTPGLMSVVLGIVPVIIAWLYSEYLHYAKHSVSATKAHSDVNLVEIAKDFVKEDDKALLIEDGGALQSASPRAK
APSTHSPLVRFALLDESFLVDNRLTLRAIIEFAALMLYFYVCDRTDFFNSSKKSYNRDLFLFLYFLLIIVSAITSFTIHN
DKSAFNGKAIMYLNRHQTEEWKGWMQVLFLMYHYFAAAEYYNAIRVFIACYVWMTGFGNFSYYYIRKDFSLARFAQMMWR
LNFLVIFSCIVLNNSYMLYYICPMHTLFTLMVYGALGIMNKYNEIGSVIAAKFFACFVVVIIVWEIPGVFEWIWSPFTLL
MGYNDPAKPQLPLLHEWHFRSGLDRYIWIIGMLYAYYHPTVESWMDKLEEAEMKFRMAIKTTVALIAITVGYFWFEYIYK
LDKLTYNKYHPYTSWIPITVYICLRNITQSFRGYSLTLLAWLGKITLETYISQFHIWLRSGVPDGQPKLLLSLIPDYPLL
NFMLTTSIYVAVSYRLFELTNTLKTAFIPTKDDKRLVYNTISGLIICTCLYFFSFVLITIPRKLV*

DNA
ATGGCGATTTCAAGCCCTCTTACACCTGGGCTAATGTCGGTGGTGCTTGGGATTGTTCCGGTGATCATTGCTTGGCTATA
CTCCGAGTATCTGCACTACGCTAAACATTCCGTCTCCGCCACCAAAGCGCACTCTGATGTCAATTTGGTGGAAATTGCTA
AAGACTTTGTCAAAGAAGATGACAAAGCTCTTTTAATTGAAGATGGAGGTGCTCTCCAGTCAGCTTCTCCTAGAGCCAAG
GCCCCATCCACACATTCTCCTCTCGTCAGGTTTGCCCTCTTGGATGAGTCCTTCTTGGTCGATAACAGACTTACGTTAAG
AGCAATAATTGAGTTTGCGGCACTTATGCTATACTTTTACGTGTGTGACCGTACGGATTTCTTCAATTCATCAAAGAAGA
GTTACAACCGAGATCTCTTTCTGTTCCTATACTTCCTTCTCATCATCGTTTCAGCGATAACTTCATTCACGATTCATAAT
GATAAATCAGCATTCAACGGAAAAGCCATCATGTACTTGAATAGGCATCAAACCGAGGAGTGGAAAGGCTGGATGCAGGT
CCTCTTTTTGATGTACCACTACTTTGCTGCTGCAGAATACTATAATGCAATCCGTGTATTCATTGCATGCTATGTATGGA
TGACTGGATTTGGGAATTTTTCTTATTATTACATTCGCAAGGACTTTAGCCTTGCAAGGTTTGCACAGATGATGTGGCGG
CTAAATTTCCTGGTCATATTCTCCTGCATCGTCCTCAACAACAGTTATATGCTATACTACATCTGCCCAATGCACACTCT
GTTTACTCTGATGGTCTATGGAGCACTTGGTATCATGAACAAGTATAATGAGATTGGTTCAGTCATAGCTGCCAAATTTT
TTGCCTGCTTCGTTGTTGTCATCATTGTTTGGGAAATTCCTGGCGTTTTTGAATGGATTTGGAGTCCATTTACCCTCCTA
ATGGGTTACAATGATCCTGCAAAACCACAGCTTCCCCTCTTGCATGAGTGGCATTTCCGCTCTGGCCTTGATCGGTACAT
ATGGATAATCGGGATGCTATATGCATATTACCACCCAACTGTTGAAAGTTGGATGGATAAACTGGAGGAAGCTGAGATGA
AGTTCAGGATGGCTATCAAGACAACTGTGGCACTTATTGCAATAACGGTGGGATATTTTTGGTTCGAGTACATATACAAG
CTGGACAAGCTAACTTACAACAAATATCATCCTTACACCTCTTGGATTCCTATAACTGTTTATATTTGTCTCCGGAACAT
CACCCAGTCTTTCCGCGGCTACAGTTTGACCCTCCTGGCGTGGCTTGGGAAGATAACACTCGAGACATATATCTCCCAGT
TTCATATATGGCTCAGATCCGGAGTTCCTGATGGTCAACCCAAATTACTACTCTCTCTTATCCCGGATTACCCATTGTTG
AACTTCATGCTCACAACTTCTATTTACGTCGCTGTCTCTTATAGGCTCTTTGAGCTTACCAACACTTTGAAAACAGCCTT
CATACCAACCAAGGACGACAAACGCCTGGTCTACAACACGATCTCAGGACTCATAATCTGCACTTGTCTCTACTTTTTCT
CATTCGTTCTTATCACAATTCCCCGAAAACTGGTGTGA