Details for Capsella Locus Carubv10013394m

Position : scaf_3 ( 5`- 2319747 .. 2322715 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013394m

Protein [Map View]
MGVIFDSWCFCKGVGKSEKMKASIFSGKAPAMARISVSGPNGVTSGTGFLIHRNLLLTTHLNLPSIAATETAEVRLQNGV
AAALFPHRFFITSSVIDLTIVGLDLVDGDSNSQSQTQQPHYLKTCSKPNLDLGSVVYLLGYAAQNELKIGEGKLVVATDN
LIKLSTDEMIWSPGSAGFDVQGNLAFMICDPRKLSTSPASNSSSSSSSLRKDNNKTLMMQFGIPIPVICDWLNQHWEGSL
DEHTTKPKLPLIRLMSSGQKSERSCTSFTMRSVFKPNDSADVGTPSSSNNRDQIHPSSSIAADEEKEEETSKANPQGGRT
STHGQGIPTPEIYESPKLTSGPLRNETGQVHLLDINFPPRIPKAITFLPELNSLQGNNMVEEADTASEGSDAQIASTGSV
NGALSEVISCSPPAAAHYVYNNHGYSSEEETMYSAETAESRNYPTPPRKSEFHHERVGRSQSCVSSSRWGTPQKSSDGRR
AMLEKQRSFVHGKKMQSQGAMSQRSNDYYSPTVSSIMKKRNNSSEQHIFKPVPRPRAVSSSPRWAF*

DNA
ATGGGAGTGATATTTGACTCATGGTGCTTTTGCAAAGGAGTAGGCAAAAGTGAGAAGATGAAAGCTTCCATTTTCTCCGG
CAAAGCTCCGGCGATGGCTCGTATCTCTGTCTCCGGGCCAAATGGGGTTACTTCCGGCACTGGATTCCTCATTCACAGGA
ATCTTCTTCTGACCACTCACCTCAATCTCCCTTCCATCGCCGCCACCGAAACCGCGGAGGTCCGCCTTCAGAACGGTGTT
GCCGCTGCTCTCTTCCCTCACAGGTTTTTCATTACAAGCTCGGTTATTGATCTCACCATTGTTGGCTTAGACCTTGTTGA
TGGAGATTCAAATTCTCAGAGCCAAACCCAACAGCCACATTACCTGAAAACATGTTCCAAACCAAACCTGGATCTAGGAA
GTGTGGTGTACCTCTTAGGCTATGCTGCTCAGAATGAACTAAAGATTGGCGAGGGGAAGTTAGTGGTAGCCACTGATAAT
CTCATCAAACTCTCAACTGATGAAATGATCTGGAGTCCTGGATCTGCTGGATTTGATGTTCAAGGGAATCTCGCATTCAT
GATCTGTGATCCAAGGAAGCTTTCGACATCACCAGCCTCAAACTCGTCATCTTCCTCTTCGTCATTGAGAAAAGATAACA
ACAAGACACTAATGATGCAGTTTGGTATACCCATACCAGTTATCTGTGACTGGCTTAATCAGCATTGGGAAGGTAGTTTG
GATGAACATACGACAAAACCCAAGTTGCCTCTCATTCGGTTAATGTCTTCTGGTCAGAAGAGCGAGCGTTCTTGTACTTC
CTTCACCATGCGCAGTGTTTTCAAGCCAAACGACTCTGCTGATGTTGGAACCCCATCTTCATCTAACAATAGAGATCAAA
TTCATCCCAGCTCTTCCATCGCTGCTGATGAAGAAAAAGAAGAAGAAACCTCAAAAGCCAATCCTCAAGGCGGCAGAACT
TCTACTCATGGGCAGGGTATCCCAACCCCTGAGATATATGAATCCCCAAAGTTGACTTCTGGTCCTTTAAGAAATGAGAC
AGGTCAAGTACACCTTTTGGATATCAACTTTCCTCCACGGATACCTAAAGCTATAACCTTTCTTCCTGAGCTCAACTCTC
TTCAGGGTAACAACATGGTGGAAGAGGCTGACACTGCCTCTGAAGGATCAGATGCGCAAATTGCTTCGACAGGTTCAGTT
AACGGTGCTCTCAGTGAGGTCATCTCATGTTCACCGCCAGCAGCAGCTCACTATGTATATAACAATCATGGATACAGCAG
CGAGGAAGAGACGATGTATTCTGCAGAAACAGCAGAAAGCCGAAACTACCCTACTCCTCCAAGGAAGAGTGAGTTTCATC
ATGAGAGAGTTGGAAGGAGCCAAAGTTGTGTTAGCTCCAGCAGATGGGGAACTCCTCAAAAGAGTTCGGATGGTAGAAGA
GCAATGCTGGAGAAACAGAGAAGCTTCGTCCATGGAAAGAAGATGCAATCACAAGGAGCAATGTCACAGAGGAGCAATGA
CTATTACAGCCCAACGGTATCATCCATCATGAAGAAGAGGAATAATAGTTCAGAGCAACATATTTTCAAACCGGTACCTA
GACCTAGAGCTGTTAGTTCTTCCCCAAGATGGGCATTCTGA