Details for Capsella Locus Carubv10013378m

Position : scaf_3 ( 5`- 7100179 .. 7104647 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013378m

Protein [Map View]
MHRQGSSPITPLSFNAAVSIASDVPSGLTKSPLSHAIPVSPISAAYPSGDPMLMMSGSALARVRLSDILPYEGAPSPAYA
KAVEALSVSLMRYNASVIELGSEDTALIRCGLEAARLYFRTRSLNVSGKGNRGLSMYRAGRSVEDLDSSPPCMAEIFRCL
GKVARAALSAIARHLRLRSDVFNHMLDDFPLAPNEVSSSVLLASYAHASIQNGKYASGGGSLSTNIEVEKGLLTMFCSDG
TGIQVCDPNGRWYTADNGCGVGDLLLITGKALSHATAGLRPAASYRTDHLSGIDNRGRASLAFRLMPKSNAILDCSPIEA
AGHVIPQSYVPVSVSQFMDNLLAENDTIVNPPVKTNVPRDDVCKEPSLRSVLSDPISGAFLEDAMVVSCGHSFGGLMLRR
VLEMSRCTLCNAEIESGSLVPNHALRAAASAIKQQDDKRLFHNAAMRRRRKEMSDQMDVENGDPATDDGMHRVVHYPFAV
NEKVLIKGNRRTPEKFVGKEAIVTSQCLNGWYLLKIVESGDNVRLQYRSLKKMVNDDRGVGLHSQPVESNSL*

DNA
ATGCACCGGCAGGGCTCGTCTCCGATTACGCCTTTAAGCTTTAACGCCGCCGTTTCAATTGCTTCTGATGTACCTAGTGG
CTTAACCAAGTCTCCTTTGTCTCACGCGATTCCAGTTTCGCCGATTTCTGCTGCTTACCCGTCTGGTGATCCTATGCTGA
TGATGTCTGGGAGTGCTCTCGCTAGGGTTCGATTATCTGATATTTTGCCTTATGAAGGAGCTCCTTCTCCGGCGTATGCT
AAAGCCGTAGAGGCTTTGTCTGTATCTTTGATGAGGTATAATGCCTCTGTGATCGAACTAGGGAGTGAAGACACTGCACT
GATTCGATGTGGCCTTGAAGCTGCTCGTTTGTATTTTAGAACTAGAAGCCTTAATGTTTCTGGTAAAGGCAATCGTGGCC
TCTCTATGTATAGAGCTGGAAGGTCTGTTGAGGATTTAGATTCTTCGCCACCATGCATGGCTGAGATTTTCCGGTGCTTG
GGTAAAGTAGCACGAGCTGCTTTATCTGCAATAGCAAGGCATCTACGTCTAAGAAGCGATGTTTTTAACCATATGCTGGA
CGACTTTCCACTAGCTCCGAATGAGGTTTCCTCCTCGGTGCTACTGGCTTCCTATGCTCATGCCTCAATCCAAAATGGAA
AATATGCTTCTGGAGGTGGCAGCCTATCTACTAATATTGAAGTTGAAAAGGGTTTGTTGACAATGTTCTGCTCAGATGGC
ACTGGCATTCAGGTATGTGACCCAAATGGTCGTTGGTACACAGCAGATAATGGATGTGGGGTGGGTGATCTCTTACTGAT
TACCGGCAAAGCGCTTAGTCATGCTACTGCAGGTCTCCGTCCAGCTGCCTCTTACAGAACCGACCATTTGTCTGGCATTG
ACAATCGCGGAAGGGCATCATTAGCTTTTAGGCTTATGCCGAAAAGTAATGCTATATTAGATTGTTCCCCAATAGAAGCA
GCCGGCCATGTAATTCCTCAAAGCTATGTGCCAGTATCTGTTAGTCAGTTTATGGATAACCTCTTGGCCGAGAATGACAC
TATAGTTAATCCGCCTGTGAAAACCAATGTTCCGCGGGATGATGTTTGCAAAGAGCCTTCCTTAAGAAGTGTTCTCTCGG
ATCCAATTTCTGGTGCTTTTCTTGAAGATGCAATGGTTGTCTCTTGTGGACATTCATTTGGTGGCCTCATGCTTAGAAGA
GTCCTTGAAATGTCTAGATGTACGCTCTGCAATGCAGAAATCGAGTCTGGGTCTCTGGTTCCCAACCATGCACTTAGAGC
TGCCGCTTCAGCTATAAAGCAACAAGATGACAAAAGACTTTTCCACAACGCAGCCATGAGGAGGCGTAGAAAAGAAATGA
GTGATCAAATGGATGTGGAAAATGGAGATCCAGCTACGGATGATGGAATGCATCGAGTGGTGCATTATCCATTTGCTGTA
AATGAGAAAGTGCTTATCAAGGGAAACCGGAGGACCCCGGAAAAGTTTGTTGGAAAAGAAGCAATCGTGACATCTCAATG
TCTCAATGGCTGGTATCTATTAAAGATTGTCGAAAGCGGAGACAATGTGCGGCTGCAATACCGATCCCTAAAAAAGATGG
TGAACGATGACAGAGGAGTAGGCTTACACTCTCAACCGGTTGAGAGCAATAGCTTGTAG