Details for Capsella Locus Carubv10013375m

Position : scaf_3 ( 5`- 3506375 .. 3509036 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013375m

Protein [Map View]
MGSNCDGNLKAEIEESNGSSGKASVPPCPLDLSTSRRTLIGDGKPKRWSFGALPDASSRLKLLKFGSPSAKFKKMAENRD
EVSRSVTSSSSGSSHNFRERISGVLHRKIDWSSLVKMGKEWIRNPINMALFVWILVVGVSGAILFMVMTGMLNHALPKKS
QRDAWFEVNNQILNGLFTLMCLYQHPKRFYHLVLLCRWKRDDITKLRNAYCKNGTYKPNEWMHILVVIILLHLNCFAQYA
LCGLNVGYRRSERPPIGVAVCISFAIGAPAVAGLYTILSPLGKDYDESIEDEENQLQREEGSTNRRFTLERRFSFASAST
GVGDGMVPVSNPQWSGGILDIWDDISLAYLSLFCTFCVFGWNMERVGFGNMYVHIATFILFCLAPFFIFNLAAVNIDNET
VREALGVSGILLCVFGLLYGGFWRIQMRKRFKLPSYKFCFGRAAVADCALWLFCCWCSLAQEVRTANSYEIVEDKFCQRA
EEKSMVSPLPREDGVFDPRFGLGSSPKNMSGASSPSPSRFWKEVHSPNVQTPRVKEEDKSEVVLTPPSPLSIHREA*

DNA
ATGGGATCGAATTGTGATGGGAATTTGAAAGCAGAGATTGAGGAATCTAATGGTTCTTCTGGTAAAGCTAGTGTTCCTCC
TTGTCCTCTTGATCTTTCTACATCTCGAAGAACTCTGATTGGTGATGGTAAACCTAAGAGATGGTCATTTGGTGCTTTGC
CTGATGCTTCTAGTAGACTCAAGCTTCTCAAATTTGGTTCTCCTTCTGCTAAATTCAAGAAAATGGCTGAGAACAGAGAC
GAGGTTTCACGGTCTGTCACCAGCTCAAGTAGCGGTAGCAGCCATAATTTCAGGGAAAGAATCAGTGGTGTGCTTCACCG
GAAGATCGATTGGAGTTCTCTGGTGAAAATGGGGAAAGAATGGATTAGGAATCCTATAAACATGGCTCTCTTTGTGTGGA
TACTTGTTGTTGGAGTCTCTGGTGCTATTCTCTTCATGGTTATGACTGGTATGTTGAATCATGCTTTGCCTAAGAAGTCT
CAGAGAGATGCTTGGTTTGAAGTTAACAACCAGATCCTTAATGGGTTGTTTACTTTGATGTGTCTTTATCAACATCCGAA
ACGGTTTTATCACTTAGTGCTTCTCTGTAGATGGAAGCGCGATGATATTACAAAGCTTAGGAATGCTTATTGCAAGAACG
GGACTTATAAGCCGAATGAATGGATGCATATATTGGTTGTTATCATTTTGCTTCACTTGAATTGTTTTGCTCAGTACGCT
CTTTGTGGTCTTAATGTTGGATACAGGAGATCAGAGAGACCTCCCATTGGAGTCGCTGTATGTATCTCTTTCGCGATTGG
AGCCCCTGCAGTTGCGGGTTTGTACACTATATTAAGTCCACTTGGGAAAGATTATGATGAGTCGATTGAAGACGAGGAGA
ATCAACTGCAGCGTGAAGAAGGGTCTACGAATCGCCGGTTTACTCTAGAGAGGAGGTTTTCGTTTGCTTCTGCTTCCACG
GGGGTTGGGGATGGAATGGTTCCTGTGAGTAATCCTCAATGGAGTGGTGGGATTTTGGATATTTGGGATGATATTTCATT
GGCTTATCTTTCTCTTTTCTGCACTTTCTGTGTCTTTGGATGGAACATGGAGAGAGTTGGGTTTGGGAACATGTATGTTC
ACATAGCGACATTTATTCTCTTTTGTTTGGCACCTTTCTTTATATTCAACTTAGCTGCGGTTAATATCGATAATGAGACA
GTTAGGGAGGCGCTTGGTGTATCTGGAATCCTTCTTTGTGTGTTTGGTTTGCTCTATGGTGGATTCTGGAGAATTCAAAT
GAGGAAAAGATTCAAATTGCCGAGTTATAAGTTCTGCTTTGGTAGAGCTGCGGTTGCTGATTGTGCGCTCTGGTTATTCT
GTTGCTGGTGCTCCTTAGCTCAAGAAGTTCGGACTGCAAACTCTTATGAGATAGTGGAAGACAAATTCTGCCAAAGAGCT
GAAGAGAAGAGTATGGTATCTCCTCTGCCTCGTGAAGATGGTGTGTTTGATCCTCGGTTTGGTCTCGGGAGCTCCCCCAA
AAACATGAGCGGAGCTAGTTCTCCGAGCCCGAGCAGGTTTTGGAAAGAGGTACATAGTCCAAATGTACAGACGCCTAGAG
TAAAAGAAGAAGATAAAAGTGAGGTTGTTCTGACTCCACCATCTCCGCTGTCAATACACCGAGAAGCTTGA