Details for Capsella Locus Carubv10013373m

Position : scaf_3 ( 5`- 3837114 .. 3842523 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013373m

Protein [Map View]
MASMMQPQIILLKEGTDTSQGKAQLLSNINACTAVGDVVRTTLGPRGMDKLIHDDKGSVTISNDGATIMKLLDIIHPAAK
ILVDIAKSQDSEVGDGTTTVVLLTAEFLKEAKPFIEDGVHAQNLIRSYRTACTLAIAKVKELAVSIEGKSVEEKKGLLAK
CAATTLSSKLIGGEKEFFATMVVDAVMAIGHDDRLNLIGIKKVPGGNMRDSFLVDGVAFKKTFSYAGFEQQPKKFVNPKI
LLLNIELELKSEKENAEIRLSDPSQYQSIVDAEWNIIYDKLDKCVESGAKVVLSRLAIGDLATQYFADRDIFCAGRVAEE
DLNRVAAAAGGTVQTSVNNIIDEVLGTCEIFEEKQVGGERFNIFSGCPSGRTATIVLRGGADQFIEEAERSLHDAIMIVR
RAVKNSTVVPGGGAIDMEISKYLRQHSRTIAGKSQLFINSYAKALEVIPRQLCDNAGFDATDVLNKLRQKHAMQSGEGAS
YGVDINTGGIADSFANFVWEPAVVKINAINAATEAACLILSVDETVKNPKSESAQGDAAGAMGRGRGGGRGRGMRRR*

DNA
ATGGCGTCGATGATGCAACCGCAGATCATACTGTTGAAGGAAGGTACGGACACATCTCAAGGGAAAGCACAGCTACTGAG
CAACATCAACGCTTGCACGGCGGTTGGAGATGTAGTTCGAACCACGCTCGGGCCACGAGGGATGGACAAACTCATTCACG
ACGATAAAGGATCCGTCACCATTTCCAACGATGGTGCTACCATCATGAAGCTCCTCGACATTATTCATCCTGCTGCTAAG
ATCCTCGTCGATATCGCTAAATCCCAAGATTCTGAGGTGGGTGATGGAACAACAACTGTTGTTCTTCTTACAGCAGAGTT
TTTGAAGGAGGCTAAGCCATTTATTGAGGATGGTGTTCACGCCCAGAATTTAATCAGGAGTTACCGCACTGCCTGCACTT
TGGCAATTGCCAAAGTTAAAGAACTCGCTGTTAGCATTGAGGGGAAGAGTGTAGAGGAAAAGAAAGGTTTATTGGCTAAA
TGCGCTGCTACTACTCTTTCATCTAAGCTTATCGGTGGGGAAAAGGAGTTTTTTGCTACAATGGTTGTTGATGCTGTTAT
GGCGATTGGTCATGACGACAGGCTAAATCTGATTGGGATCAAGAAGGTTCCTGGTGGCAATATGCGAGACTCTTTCCTCG
TTGATGGTGTTGCTTTCAAAAAGACATTCTCATATGCGGGTTTTGAGCAACAGCCTAAGAAATTTGTTAACCCCAAAATT
CTCTTACTTAACATCGAATTGGAGTTGAAATCTGAGAAGGAAAACGCTGAAATTAGGCTGTCAGATCCATCACAGTACCA
GTCAATCGTTGATGCAGAATGGAATATCATTTATGACAAGCTAGACAAATGTGTTGAGAGTGGAGCAAAAGTTGTTCTTT
CTCGACTGGCAATTGGTGATTTAGCAACTCAGTACTTTGCGGATCGAGATATTTTCTGTGCTGGTCGGGTAGCAGAAGAA
GATCTTAACCGTGTGGCTGCAGCAGCTGGAGGAACAGTTCAGACAAGTGTTAACAACATAATAGATGAGGTTCTTGGAAC
TTGTGAAATTTTCGAGGAAAAACAAGTTGGTGGGGAGAGGTTTAACATATTCAGTGGTTGCCCTTCAGGCCGTACAGCCA
CTATTGTCCTCCGTGGTGGAGCTGATCAGTTCATCGAAGAAGCTGAGCGGAGTTTACATGATGCAATTATGATTGTGAGA
AGAGCTGTTAAAAACTCAACTGTTGTCCCTGGAGGTGGAGCTATAGATATGGAGATAAGCAAGTACCTGAGGCAGCATTC
AAGAACAATTGCTGGGAAATCACAGCTTTTCATCAATTCTTATGCAAAGGCTCTGGAGGTTATTCCACGACAGTTATGTG
ACAATGCTGGATTTGATGCAACTGATGTCTTAAATAAACTAAGACAAAAACACGCCATGCAAAGCGGTGAAGGAGCTTCT
TATGGAGTAGACATTAATACTGGTGGAATAGCAGATTCTTTTGCTAACTTCGTGTGGGAACCAGCAGTTGTGAAGATCAA
TGCAATAAATGCTGCGACTGAAGCGGCTTGCCTCATTCTAAGTGTGGACGAGACTGTGAAGAACCCTAAATCGGAGAGTG
CACAGGGAGATGCTGCAGGTGCAATGGGGAGAGGACGTGGTGGAGGTCGTGGCCGTGGAATGCGAAGGCGATAA