Details for Capsella Locus Carubv10013366m

Position : scaf_3 ( 5`- 379025 .. 383418 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013366m

Protein [Map View]
MAMKNLLSLARRSQRRLSLNQVTRSSSSFSAIDSAPASTSPATPSPPPPHLMPYDHAAELIKNKIKKLENPDKRFLKYAS
PIPILASHNHILSAPETRVTTLPNGLRVATESNLSAKTATVGVWIDAGSRFESDETNGTAHFLEHMIFKGTGKRTVRALE
EEIEDIGGHLNAYTSREQTTYYAKVMDSNVNQALDVLADILQNSKFEEDRINRERDVILREMQEVEGQTDEVVLDHLHAT
AFQYTPLGRTILGPAQNVKSITREDLQNYIKTHYTASRMVLILVTSYHFLQSAIEFVRILMLAYPKYIQVIAAAGAVNHE
EVVEQVKKLFTKLSSDPTSTSQLVANEPASFTGSEVRMIDDDLPLAQFAVAFEGASWTDPDSVALMVMQTMLGSWNKNVG
GGKHVGSDLTQRVAINEIAESIMAFNTNYKDTGLFGVYAVAKADCLDDLSYAIMYEVTKLAYRVSDADVTRARNQLKSSL
LLHMDGTSPIAEDIGRQLLTYGRRIPIAELFARIDAVDASTVKRVANKYVYDKDIAISAIGPIQDLPDYNKFRRRTYWNR
Y*

DNA
ATGGCGATGAAGAATCTACTGTCCCTAGCTCGCCGATCTCAGAGGCGTTTGTCTCTGAATCAAGTCACACGATCCTCCTC
TTCGTTTTCAGCTATCGATTCGGCGCCGGCTTCCACATCTCCGGCGACCCCATCCCCGCCGCCGCCGCATCTGATGCCAT
ACGATCACGCCGCCGAGCTTATTAAAAATAAGATCAAGAAGCTCGAGAATCCGGATAAGAGGTTCCTTAAATACGCATCG
CCAATTCCGATCCTTGCTTCCCACAATCACATCTTGTCAGCTCCGGAGACCCGTGTCACCACCTTGCCCAATGGGCTCCG
AGTGGCTACTGAGTCCAATCTCTCGGCCAAGACCGCCACCGTTGGAGTCTGGATCGACGCTGGATCTCGGTTCGAGTCAG
ATGAGACCAACGGCACTGCTCATTTTCTGGAGCATATGATTTTCAAAGGCACGGGGAAACGTACTGTGAGGGCGTTGGAG
GAAGAGATCGAAGATATTGGTGGTCATTTGAACGCTTATACATCGAGGGAACAGACCACATACTATGCCAAGGTCATGGA
TTCGAATGTGAACCAAGCTTTGGATGTGTTGGCTGATATCTTACAGAATTCCAAGTTCGAGGAAGATAGAATCAACCGGG
AACGAGATGTGATCCTCAGGGAAATGCAAGAGGTAGAGGGACAAACAGATGAAGTGGTTCTTGACCATTTACATGCTACT
GCATTCCAATATACACCCCTTGGAAGAACTATTCTGGGGCCTGCTCAGAACGTTAAGTCGATCACCAGAGAGGACCTACA
GAACTACATTAAGACTCACTACACAGCTTCCAGGATGGTATTAATTTTGGTTACCTCTTATCATTTCTTGCAATCTGCTA
TTGAATTTGTTAGGATTCTTATGTTGGCTTATCCAAAATATATTCAGGTGATTGCTGCTGCAGGAGCCGTCAATCATGAG
GAAGTTGTTGAGCAAGTGAAGAAGCTATTTACCAAGTTGTCATCTGATCCAACATCTACTTCCCAACTGGTTGCCAATGA
ACCTGCTAGTTTTACTGGTTCTGAGGTCCGAATGATTGATGATGACCTACCCCTTGCACAATTTGCTGTTGCCTTTGAGG
GAGCATCTTGGACAGATCCAGATTCGGTTGCGCTTATGGTTATGCAAACCATGTTGGGTTCTTGGAACAAAAATGTTGGT
GGGGGAAAACACGTGGGTTCTGACCTGACCCAGAGGGTTGCCATTAATGAAATAGCAGAAAGCATAATGGCATTCAACAC
CAACTACAAGGATACTGGACTGTTCGGCGTGTATGCAGTTGCTAAGGCCGATTGCTTGGATGATCTATCATATGCCATTA
TGTATGAGGTAACCAAGCTGGCCTACCGAGTTTCAGACGCTGATGTGACACGTGCACGGAATCAGCTGAAATCGTCATTG
TTACTTCACATGGATGGAACTAGCCCAATTGCTGAAGACATTGGTCGTCAGCTCCTGACCTATGGGCGTAGAATCCCAAT
CGCTGAACTCTTTGCTAGGATTGATGCTGTTGATGCCAGCACGGTAAAACGTGTTGCCAACAAATATGTGTATGACAAGG
ACATTGCGATCTCAGCCATCGGTCCCATCCAAGACTTGCCAGACTACAACAAGTTCAGACGCAGAACCTACTGGAACCGT
TACTAA