Details for Capsella Locus Carubv10013364m

Position : scaf_3 ( 5`- 7055592 .. 7058433 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013364m

Protein [Map View]
MSDLQTPLVRPKRKKTWVDYFVKFRWIIVIFIVLPFSATLYFLIYLGDIWSESKSFEKRQKEHDENVKKVIKRLKDRDAA
KDGLVCTARKPWIAVGMRNVDYKRARHFEVDLGEFRNVLEVNKEKMIARVEPLVNMGQISRVTCPMNLALAVVAELDDLT
VGGLINGYGIEGSSHIYGLFADTVEAYEIVLAGGELVRATRDNEYSDLFYAIPWSQGTLGLLVAAEIRLIPIKEYMRLTY
IPVKGDLQALAQGYIDSFAPKDGDKSKIPDFVEGMVYNPTEGVMMVGTYASKEEAKKKGNKINNVGWWFKPWFYQHAQTA
LKKGQFVEYIPTREYYHRHTRCLYWEGKLILPFGDQFWFRFLFGWLMPPKVSLLKATQGEAIRNYYHDMHVIQDMLVPLY
KVGDALEWVHREMEVYPIWLCPHKLFKQPIKGQIYPEPGFEYENRQGDTEDAQMFTDVGVYYAPGPVLRGEQFDGSEAVR
KMEKWLIENHGFQPQYAVSELDEKSFWRMFNGELYEECRKKYRAIGTFMSVYYKSKKGRKTEKEVREAEQAHLETAYAEA
D*

DNA
ATGTCGGATCTTCAGACACCACTTGTGAGGCCGAAGAGGAAGAAGACATGGGTTGATTACTTTGTCAAGTTCAGATGGAT
CATTGTCATCTTCATCGTCCTTCCCTTCTCAGCCACACTCTACTTCCTCATCTACCTCGGGGACATCTGGTCGGAGTCCA
AGTCCTTTGAGAAACGCCAGAAGGAGCATGACGAGAATGTGAAGAAAGTCATCAAAAGGCTTAAGGATAGGGACGCGGCC
AAGGACGGGCTGGTCTGCACTGCGCGTAAGCCTTGGATCGCTGTGGGAATGAGGAACGTTGACTACAAGAGAGCCCGGCA
TTTCGAGGTTGACTTGGGAGAGTTCCGTAACGTTCTTGAGGTCAACAAGGAGAAGATGATTGCTAGAGTGGAGCCTCTTG
TCAACATGGGACAGATTTCTCGTGTCACTTGCCCAATGAACCTGGCTCTCGCTGTTGTTGCTGAGCTTGATGACCTCACG
GTTGGTGGACTCATCAATGGATATGGTATTGAAGGAAGCTCTCACATCTATGGTTTGTTCGCAGATACCGTCGAGGCTTA
TGAGATCGTTCTAGCTGGTGGGGAACTTGTCCGTGCCACAAGGGATAATGAGTATTCCGATCTTTTCTATGCAATCCCGT
GGTCGCAAGGAACGCTCGGACTCCTTGTAGCCGCAGAGATCAGGCTTATTCCAATCAAGGAGTACATGAGACTCACTTAC
ATTCCAGTCAAGGGAGATCTTCAAGCCTTGGCTCAAGGTTACATCGATTCTTTCGCGCCAAAAGACGGTGACAAGTCAAA
AATCCCGGATTTCGTTGAAGGCATGGTTTACAACCCAACTGAAGGAGTGATGATGGTTGGAACATACGCATCTAAAGAAG
AGGCAAAGAAGAAAGGGAACAAAATCAACAATGTGGGATGGTGGTTCAAGCCATGGTTCTACCAGCATGCGCAGACCGCG
CTGAAAAAGGGACAGTTTGTTGAGTACATCCCGACAAGGGAATACTACCACAGGCACACAAGGTGCTTGTACTGGGAAGG
CAAACTTATTCTTCCATTTGGTGATCAGTTCTGGTTCAGGTTCCTCTTTGGTTGGTTGATGCCTCCAAAGGTCTCCCTTC
TTAAGGCCACTCAAGGTGAAGCTATCAGGAACTATTACCATGATATGCATGTTATTCAGGACATGCTTGTTCCTCTTTAC
AAGGTTGGTGATGCCCTCGAATGGGTTCACCGCGAAATGGAGGTGTATCCAATTTGGCTTTGCCCACACAAACTCTTCAA
GCAGCCAATCAAAGGCCAGATCTACCCAGAACCAGGCTTTGAGTACGAGAACAGACAAGGAGACACAGAAGATGCTCAGA
TGTTCACTGATGTTGGAGTCTACTACGCACCTGGCCCTGTCCTAAGAGGAGAACAGTTTGATGGATCAGAAGCTGTGCGT
AAGATGGAGAAATGGCTGATCGAGAACCATGGATTCCAGCCTCAATACGCGGTGTCTGAGCTCGACGAGAAGAGCTTCTG
GAGGATGTTCAATGGTGAACTGTATGAGGAGTGCCGCAAGAAGTACAGAGCTATTGGAACGTTCATGAGTGTTTACTACA
AGTCCAAGAAAGGAAGAAAGACCGAGAAGGAAGTTAGAGAAGCCGAGCAAGCTCATCTCGAAACTGCTTACGCCGAGGCA
GATTAA