Details for Capsella Locus Carubv10013363m

Position : scaf_3 ( 5`- 1361433 .. 1366330 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013363m

Protein [Map View]
MASSIVFAATPVTGFLSVPPLKSRRFHVCSSLDTDVSDMSVNAPKGLFPPEPVPYKGPKLKVAIIGAGLAGMSTAVELLD
QGHEVDIYDSRTFIGGKVGSFVDRRGNHIEMGLHVFFGCYNNLFRLMKKVGAEKNLLVKDHTHTFINKDGTIGELDFRFP
VGAPIHGIRAFLVTNQLKPYDKLRNSLALALSPVVKALVDPDGAMRDIRNLDSISFSDWFMSKGGTRASIQRMWDPVAYA
LGFIDCDNMSARCMLTIFSLFATKTEASLLRMLKGSPDVYLSGPIKQYITDRGGRIHLRWGCREILYDKSADGETYVTGL
AISKATNKKIVKADVYVAACDVPGIKRLLPKEWRETRFFNDIYELEGVPVVTVQLRYNGWVTELQDIELARQLKRAVGID
NLLYTPDADFSCFADLALASPADYYIEGQGTLLQCVLTPGDPYMRMPNDKIIEKVAMQVTELFPSSRSLEVTWSSVVKIA
QSLYREAPGKDPFRPDQKTPIKNFFLAGSYTKQDYIDSMEGATLSGRQASSYICDAGEELAELNKKLSSSATAVADELSF
V*

DNA
ATGGCTTCTTCAATCGTTTTCGCTGCAACTCCGGTTACTGGCTTTCTCTCCGTTCCCCCATTGAAGTCTCGGAGGTTTCA
CGTTTGTTCTTCACTCGACACCGATGTTTCCGACATGAGTGTTAACGCTCCAAAAGGGCTATTTCCTCCAGAGCCTGTAC
CGTACAAGGGACCGAAGCTGAAAGTAGCTATCATAGGTGCTGGACTTGCTGGCATGTCAACTGCTGTAGAGCTTTTGGAT
CAGGGTCATGAGGTGGATATATATGATTCTAGGACATTCATTGGTGGCAAGGTGGGTTCTTTTGTAGATAGACGTGGGAA
CCATATCGAAATGGGACTTCATGTTTTCTTTGGATGCTACAACAATCTCTTCCGCTTGATGAAAAAGGTGGGTGCTGAAA
AAAACCTTCTTGTCAAAGACCATACTCATACATTTATAAACAAAGACGGCACAATTGGAGAGCTTGATTTTCGGTTTCCT
GTTGGAGCTCCAATTCATGGTATTCGCGCATTTTTGGTCACAAATCAACTCAAGCCCTATGATAAACTAAGGAATTCACT
GGCTCTTGCATTGAGCCCGGTTGTTAAAGCTCTTGTTGACCCTGACGGAGCAATGAGAGACATTCGCAATCTTGACAGCA
TAAGTTTCTCGGATTGGTTCATGTCAAAAGGTGGGACACGAGCAAGCATCCAGAGAATGTGGGATCCTGTTGCTTACGCA
CTCGGTTTCATAGACTGCGATAACATGAGTGCACGATGCATGCTTACCATATTTTCATTATTCGCTACCAAAACAGAAGC
TTCGTTGTTGCGTATGCTCAAGGGCTCGCCTGATGTTTACTTGAGTGGTCCTATTAAACAATATATCACAGATAGAGGCG
GCAGAATCCATTTGCGGTGGGGTTGCAGGGAGATACTTTATGATAAATCAGCAGATGGAGAAACTTATGTCACTGGACTA
GCAATATCTAAGGCTACGAACAAGAAGATTGTGAAAGCTGACGTGTATGTTGCTGCATGTGATGTGCCGGGAATCAAAAG
GTTACTTCCAAAAGAATGGAGGGAAACTCGGTTTTTCAACGATATATATGAACTCGAAGGAGTACCTGTTGTTACTGTAC
AGCTCAGATACAATGGTTGGGTCACAGAGTTACAAGACATTGAACTTGCCAGGCAGTTGAAACGAGCTGTTGGTATAGAT
AACCTTCTCTACACTCCTGATGCTGATTTCTCGTGCTTTGCGGATCTTGCACTTGCTTCGCCTGCAGATTATTATATCGA
AGGACAAGGCACTTTGCTTCAGTGCGTTCTAACACCGGGAGATCCGTACATGCGAATGCCGAACGATAAGATCATAGAGA
AAGTAGCGATGCAGGTCACTGAGTTGTTTCCATCGTCACGGAGCCTAGAAGTCACCTGGTCATCAGTTGTAAAAATAGCT
CAGTCTCTGTACCGTGAAGCACCTGGAAAAGATCCATTCAGACCCGATCAGAAGACGCCCATAAAGAATTTCTTCCTTGC
AGGTTCATACACAAAACAGGATTACATAGATAGTATGGAAGGAGCGACATTATCAGGAAGACAAGCCTCGTCATACATCT
GTGACGCCGGTGAAGAACTAGCAGAGCTAAACAAGAAGCTTTCGTCCTCTGCAACTGCAGTTGCTGATGAGCTAAGTTTT
GTCTAA