Details for Capsella Locus Carubv10013357m

Position : scaf_3 ( 5`- 3353628 .. 3356558 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013357m

Protein [Map View]
MELSSEDNNLTDKVLPPVEQESDVELETKVKKYLRGEGANLEVYNMHIALMIVAFRCEMQFLIMVSTCLLQTLEDKKLKT
HLASREKLYGKSAKAAAKIEKWLLPAEAGYLETDGLEKTWRVKQTDIANEVDLLSSRNQYDIVLPDFGPYRLDFTASGRH
MLAGGRKGHIALVDMMSMNLIKEIQVRETVRDVAFLHNEQFFAAAQKKYAYIYGRDGTELHCLKERGPVARLQFLKNHFL
LASVNKSGQLHYQDVTYGGMVASIRTGKGRTDVMEVNPYNGVVALGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHP
NGHLMATSGKERKIKIWDLRKFEEIQTIHGFHAKTLSFSQKGLLAAGTGSFVQILGDSSGGSSHNYSRYMNHPMVKGYQI
EKLMFRPYEDVIGIGHSMGWSSILIPGSGEPNFDSWVANPFETSKQRREKEVHMLLDKLPPETIMLDPSKIGAMRPSRRK
EKPSRGEIEAEKEVAIEAAKSTELKNKTKGRNKPSKRTKKKKEMVENAKRTFPEQGHNTTLKKRRIGEDAAAELPTSLKR
FARKN*

DNA
ATGGAGCTCAGTTCGGAGGATAACAATCTTACAGACAAGGTTTTGCCTCCTGTTGAGCAGGAGAGCGATGTTGAGTTGGA
GACTAAAGTTAAGAAATATCTTAGAGGAGAAGGTGCCAATCTTGAGGTATACAATATGCATATAGCTTTGATGATTGTGG
CTTTCCGTTGTGAAATGCAGTTTTTGATTATGGTTTCTACTTGTCTTCTGCAGACATTGGAAGATAAGAAGCTAAAAACT
CATCTTGCTTCCCGTGAAAAGCTGTATGGAAAATCTGCAAAAGCAGCTGCTAAAATTGAGAAGTGGCTCTTGCCTGCTGA
GGCAGGTTACTTGGAGACTGATGGTCTAGAGAAGACATGGCGTGTCAAGCAGACAGATATTGCCAATGAAGTAGATTTAC
TCAGCTCAAGAAACCAATATGACATAGTGCTCCCAGATTTTGGCCCTTACAGACTAGATTTTACTGCCAGTGGTCGGCAT
ATGCTAGCTGGTGGTCGCAAAGGCCACATTGCTCTTGTAGACATGATGAGTATGAACCTAATCAAAGAGATTCAGGTAAG
AGAAACAGTCCGCGATGTTGCCTTCCTGCACAATGAACAATTCTTTGCAGCTGCCCAGAAGAAGTATGCTTATATATATG
GGAGAGATGGAACTGAGCTGCATTGTTTGAAGGAACGTGGTCCAGTGGCCAGACTTCAGTTCCTAAAGAACCATTTTCTG
CTTGCATCAGTAAATAAATCTGGGCAGCTACATTATCAAGATGTAACCTATGGAGGCATGGTTGCTAGTATACGAACAGG
TAAAGGCCGAACAGATGTAATGGAAGTGAATCCTTACAATGGTGTTGTTGCCTTGGGACATTCTGGTGGAACTGTCACAA
TGTGGAAACCCACTAGCCAAGCACCTCTAGTCCAGATGCAGTGTCACCCTGGGCCAGTTTCATCTGTTGCATTTCATCCA
AATGGCCATCTCATGGCTACATCTGGTAAAGAGCGCAAAATCAAGATCTGGGATTTACGTAAATTCGAGGAAATTCAGAC
TATACACGGTTTTCATGCCAAAACGCTGAGTTTCAGTCAGAAAGGTTTGCTAGCAGCTGGAACTGGATCGTTTGTTCAGA
TTTTAGGAGATTCGAGTGGTGGTTCTTCACATAACTATAGTAGATACATGAACCACCCCATGGTGAAAGGTTATCAAATC
GAGAAGCTTATGTTCAGACCATATGAGGATGTTATTGGGATTGGTCACTCCATGGGTTGGTCTAGCATTCTAATACCAGG
CTCTGGAGAACCTAATTTCGATTCTTGGGTGGCTAATCCATTTGAAACATCGAAACAGAGACGGGAGAAGGAAGTCCATA
TGCTTCTTGATAAGCTTCCACCTGAGACAATCATGCTTGATCCTTCAAAGATTGGTGCGATGAGACCCTCTAGGAGGAAA
GAGAAGCCATCAAGAGGAGAGATAGAAGCTGAAAAGGAGGTGGCCATAGAAGCAGCAAAGAGCACTGAACTGAAGAACAA
GACAAAAGGAAGGAATAAGCCGAGCAAGCGGACGAAGAAGAAAAAGGAGATGGTGGAGAACGCAAAGCGAACATTCCCAG
AGCAAGGGCACAACACAACGTTAAAGAAGAGACGAATAGGAGAAGATGCTGCGGCGGAGTTACCGACGAGTCTAAAAAGG
TTTGCCAGGAAAAACTGA