Details for Capsella Locus Carubv10013356m

Position : scaf_3 ( 5`- 1521876 .. 1525301 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013356m

Protein [Map View]
MNKQDVMKLQTCVLKVNVHCEGCKHKVKKQLQKIEGVYSVKADVEQGRVTVTGNVDPALLVKKLSKSGKHAEILGGGGGG
GGGGKGFPNMNGQFANLNMNGNSKPKGGKESNQVKGKAGGGGGGGQSHGHGQPMQLTPQQIQQMMMMKAAAAHGGGGNGQ
MKMPPVAAKDQKKSVKFAEDDDDEFSEDDYDDEDFSEDDYDDDDEFDDDEDDDEEMGGHGGGNHMPPNKMMMPNKMPQMG
GGAGPKGPNEIMMMMNGFKGGAAGGGGKKGGGGFEIPVQMKGMSEGKNGKDGKKGAKGGDKGKKEGKENKGGGGKTGKTD
AKSGGGGLLGFFKKGSSGKGDEKKSGGKKDGAGGNKVKAPGGGGGGVQHYDSGPKKGGGGSKGGAHGGHDIDELMKQHSK
GGGGGNKANHNHGAKGIGGPMGQGGPMGPGGPMGMMGPGGPMGMMGPGGPMGPMGQGGAYPAVQGLPMSGGGGYYPPPPQ
ANHQMNQQQYMQMMMNHQQQQQQQQQAAAHGGYGGGHGGDMYHPMMYARPYPAVNYAHPPPMPPPHSDSYTHMFSDENPG
SCSIM*

DNA
ATGAATAAACAAGATGTTATGAAACTTCAGACATGTGTACTGAAAGTGAACGTACACTGTGAAGGGTGTAAGCATAAAGT
GAAGAAACAGTTGCAGAAAATTGAAGGCGTCTACTCTGTAAAAGCAGATGTAGAACAGGGGAGAGTCACTGTCACCGGAA
ACGTTGATCCAGCTCTTCTGGTGAAGAAACTCAGCAAATCAGGCAAACATGCCGAGATCTTAGGCGGTGGTGGAGGCGGG
GGCGGAGGAGGGAAAGGGTTCCCTAACATGAATGGGCAGTTCGCAAATCTCAACATGAATGGAAATAGTAAGCCTAAAGG
TGGGAAAGAGAGTAACCAAGTGAAGGGTAAAGCTGGTGGAGGAGGAGGAGGAGGTCAGAGTCATGGACATGGTCAACCAA
TGCAATTGACTCCTCAGCAGATTCAACAGATGATGATGATGAAGGCTGCTGCTGCTCATGGTGGTGGTGGTAACGGTCAG
ATGAAAATGCCTCCTGTTGCAGCTAAGGACCAGAAGAAGTCTGTTAAGTTTGCGGAAGATGATGACGATGAGTTTAGTGA
GGATGATTATGATGACGAGGACTTCAGTGAGGATGATTATGATGATGATGATGAGTTCGATGATGATGAAGATGACGATG
AGGAGATGGGAGGACATGGAGGAGGTAATCACATGCCTCCTAATAAGATGATGATGCCTAACAAAATGCCTCAGATGGGT
GGTGGTGCTGGACCCAAGGGGCCTAATGAGATTATGATGATGATGAATGGGTTCAAAGGCGGTGCTGCCGGCGGCGGAGG
AAAGAAAGGCGGCGGTGGGTTTGAGATTCCGGTGCAAATGAAGGGAATGAGTGAGGGTAAAAATGGAAAGGATGGTAAAA
AAGGAGCTAAAGGAGGTGACAAGGGTAAGAAAGAAGGGAAAGAGAATAAAGGAGGTGGGGGCAAAACCGGGAAAACAGAT
GCCAAAAGTGGTGGTGGTGGCCTTCTAGGGTTTTTCAAAAAGGGTAGCAGTGGGAAAGGAGATGAGAAGAAGAGCGGAGG
GAAGAAAGATGGGGCTGGGGGTAATAAAGTCAAAGCACCTGGTGGGGGAGGAGGTGGAGTTCAGCATTATGATAGTGGGC
CTAAAAAAGGTGGAGGTGGGTCTAAAGGCGGAGCCCATGGGGGCCATGATATTGATGAGCTCATGAAGCAGCACAGCAAA
GGAGGGGGTGGAGGTAACAAGGCCAATCATAACCATGGCGCCAAAGGGATTGGTGGTCCAATGGGACAAGGCGGTCCGAT
GGGCCCTGGTGGTCCGATGGGTATGATGGGTCCAGGCGGTCCAATGGGTATGATGGGTCCAGGTGGTCCGATGGGACCGA
TGGGACAGGGCGGAGCTTACCCGGCGGTTCAAGGCTTACCGATGAGCGGCGGCGGGGGTTACTATCCACCACCACCTCAG
GCAAACCATCAAATGAACCAGCAGCAGTATATGCAAATGATGATGAACCACCAGCAACAACAGCAACAACAGCAACAAGC
TGCAGCTCATGGAGGCTATGGTGGTGGTCACGGTGGCGACATGTACCATCCAATGATGTATGCTCGGCCTTATCCTGCAG
TAAATTACGCTCATCCGCCTCCAATGCCTCCTCCTCACTCGGATTCTTATACTCATATGTTCAGCGATGAGAATCCTGGT
AGTTGTAGTATCATGTAA