Details for Capsella Locus Carubv10013350m

Position : scaf_3 ( 5`- 2528484 .. 2531287 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013350m

Protein [Map View]
MGTSSGSNLPHQMLPPRQQLQTSLSLVSSDPHLSRSNSGIVRESPAESASSQETWPTSKSIMGKKAESGKSGPDSHDQLV
VRHVSIADKVSLGDIARERVDTVAERMHRLPEEYLEELKNGLKAILEGNGTQPIDEFMFLQKFVQTRSDLTSKTLVRAHR
VQLEILVVINTGIQAFLHPNINLSQTSLIEIFVYKRCRNIACQNELPADGCPCEICTNRKGFCNLCMCVICNKFDFAVNT
CRWIGCDVCSHWTHTDCAIRDGEILMGVSAKSVSGMGEMLFKCRACNHTSELLGWVKDVFQHCAPNWDRESLMKELDFVS
RIFRGSEDTRGRKLFWKCEELIDKIKGGLAEATAAKLILMFFQEIELDSPKSLESGEGGGTIAPQDACNRIAEVVKETLR
KMEIVGEEKMRMYKKARMGLEECEREVEEKAKQVAELKMERQKKKQQIEEVERIVRLKQAESEMFQLKANEAKVEAERLE
RIVKAKKEKTEEEYASNYLKLRLSEAEAEKEYLFEKIKEQESGGNGGEASQAVMYSKIREMLHGYNASSPRVDPRSNQRN
PFRSNP*

DNA
ATGGGCACATCCTCTGGATCCAATCTTCCCCACCAGATGCTGCCTCCACGCCAGCAACTACAAACTTCTCTTTCACTTGT
GTCTTCGGATCCCCACTTGTCACGATCTAATTCTGGCATTGTGCGTGAATCCCCAGCTGAAAGTGCCAGCTCTCAAGAAA
CTTGGCCGACCTCTAAATCTATTATGGGAAAGAAGGCAGAGAGCGGAAAGTCAGGTCCTGACTCTCATGACCAACTTGTG
GTCCGCCATGTTTCCATTGCCGATAAGGTATCACTAGGGGACATAGCTAGAGAGAGAGTGGACACAGTCGCTGAGAGAAT
GCACCGGTTACCAGAAGAGTATCTCGAGGAGTTAAAGAACGGCCTTAAGGCTATCCTTGAGGGTAATGGTACGCAGCCTA
TAGATGAGTTTATGTTTCTGCAGAAGTTTGTCCAGACGAGATCTGATTTAACTTCAAAGACACTTGTCAGGGCCCACAGA
GTGCAGCTTGAAATCCTTGTGGTTATAAACACTGGAATCCAAGCATTCTTGCATCCAAACATCAATCTCTCTCAGACATC
TCTCATCGAGATCTTTGTTTACAAGAGATGCAGAAACATAGCCTGCCAAAACGAACTCCCGGCTGATGGTTGTCCCTGCG
AGATTTGCACCAACAGGAAAGGCTTCTGCAACCTGTGCATGTGTGTGATCTGTAACAAGTTTGACTTTGCGGTTAACACA
TGCCGCTGGATTGGCTGTGACGTGTGCTCTCATTGGACTCATACGGATTGTGCTATAAGGGATGGAGAGATTTTGATGGG
AGTTTCTGCCAAGAGTGTATCTGGGATGGGAGAAATGCTGTTCAAGTGTCGAGCGTGCAACCATACTTCTGAATTACTAG
GCTGGGTTAAAGATGTGTTTCAGCACTGTGCACCAAACTGGGATAGGGAATCTTTGATGAAGGAACTTGACTTTGTGAGT
AGGATTTTCCGTGGAAGCGAAGATACAAGAGGCCGGAAGTTATTCTGGAAGTGTGAGGAGCTTATTGACAAGATTAAAGG
TGGACTGGCGGAAGCAACAGCTGCCAAGTTGATACTGATGTTTTTCCAAGAAATTGAATTGGACTCTCCAAAGAGCCTTG
AAAGCGGAGAAGGTGGAGGAACGATAGCTCCCCAAGATGCATGCAACAGAATTGCTGAAGTTGTAAAGGAAACACTGAGG
AAAATGGAAATAGTGGGTGAGGAAAAGATGAGGATGTACAAGAAAGCGCGAATGGGGCTAGAGGAATGCGAGAGAGAGGT
GGAAGAGAAAGCAAAGCAAGTGGCAGAACTGAAGATGGAGAGGCAGAAGAAGAAACAACAGATAGAAGAGGTGGAGAGGA
TAGTGAGGCTGAAGCAAGCTGAGTCAGAGATGTTTCAGTTAAAAGCTAATGAGGCGAAAGTAGAAGCAGAGAGATTGGAG
AGGATTGTAAAAGCGAAAAAGGAGAAAACGGAAGAGGAATATGCGAGCAACTACTTGAAACTGAGGCTGAGCGAGGCAGA
GGCAGAGAAAGAGTATCTGTTTGAAAAGATAAAAGAGCAGGAAAGTGGTGGAAATGGTGGTGAGGCGTCACAAGCAGTGA
TGTACTCAAAGATCAGAGAAATGCTTCATGGATACAATGCATCATCGCCAAGAGTAGATCCAAGATCAAACCAACGAAAT
CCATTCAGGTCCAATCCTTAG