Details for Capsella Locus Carubv10013349m

Position : scaf_3 ( 5`- 2681483 .. 2684771 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013349m

Protein [Map View]
MNRNLRESLSGGRNIPAISQFRRGSNHNSNISQNGFTRDSDENLDLFSKIRRSFPLASSDELPDVSAKLGRLSVGSKPAP
RGKGDDLLCSAEGGKNDYDWLLTPPGTPLGNDSHSSLAAPKLTSSARASSASKASRLSVSQSESSYHSSRPARSSSVTRP
SISTSQYSSFTSGRSPSNILNTSSASVSSYIRPSSPSSRSSSSARPSTPTRTSSASRASTPSRIRPGSSSSSMDKARPSL
SSRPSTPTSRPQLSANSPNIIASRPNSRPSTPTRRTPSTSVSATSGSNISSGRAASNGRSAPSLSRPSSPGPRVRTTPQQ
PIVLADFPLDTPPNLRTTLPDRPISAGRSRPVAGGSTAKASPEPKGPITRRNSSPIVTRGRLTETQGKGRYGSNGQQHLI
DAPEPRRISNVSDITSRRTVRTSSTVTDNNNGLGRSFSKSSLDMAIRHMDIRNGKTNGCALSTTTLFPQSIRPASSKIQP
IRSGNNHSDSISSNCTENGNEANEGRRLMGKLSDMDMYESSRYDALLLKEDVKNTNWLHSIDDRSSDHGLMFDNGGFELL
PEPFAPL*

DNA
ATGAATAGGAATCTCAGAGAATCTCTTTCCGGTGGGAGGAATATTCCGGCGATCTCTCAGTTTCGTAGAGGCAGCAATCA
CAACAGCAATATCTCTCAGAACGGTTTCACCAGAGATTCGGACGAGAATCTGGATCTCTTCTCTAAGATCCGACGCTCAT
TCCCATTAGCTTCCTCCGACGAATTGCCTGACGTTTCTGCAAAACTCGGGAGACTCTCGGTCGGATCCAAACCAGCTCCC
AGAGGCAAAGGTGATGATCTCTTGTGTTCTGCTGAAGGAGGAAAAAATGATTATGATTGGCTTCTTACTCCTCCTGGAAC
ACCTCTTGGAAACGACTCTCATTCATCTCTGGCAGCTCCGAAGCTTACATCTTCTGCGAGAGCTAGTTCTGCTTCAAAGG
CTTCAAGGCTTTCAGTTTCGCAGTCAGAGAGCAGTTACCATTCCTCACGTCCTGCCAGAAGTAGCTCCGTGACTCGGCCG
TCCATTTCCACCTCGCAATACAGCTCATTTACTTCAGGCCGTTCACCATCTAACATCTTGAACACTAGTTCAGCTTCAGT
CTCATCCTACATCAGACCTTCATCCCCGAGTTCCCGTTCGTCATCTTCAGCTAGACCTTCCACTCCCACCCGTACTTCTT
CGGCATCACGGGCCTCAACTCCATCGAGAATCCGTCCTGGGTCATCTAGTTCATCCATGGACAAGGCCAGACCGTCCCTG
AGCTCAAGACCATCAACTCCAACTTCTAGACCTCAGCTCTCAGCAAACTCCCCAAATATAATTGCTTCTAGACCAAATTC
TCGTCCTTCGACCCCTACCCGTCGAACCCCATCTACCTCGGTGTCTGCGACGTCAGGATCCAATATTTCTAGTGGACGAG
CTGCATCAAATGGTCGTAGTGCACCTTCATTGTCTAGGCCAAGCTCTCCTGGACCTAGAGTTAGAACCACCCCGCAACAG
CCAATTGTGCTAGCAGACTTTCCTCTTGATACTCCACCTAATCTCAGAACAACTCTCCCGGACAGACCAATATCAGCTGG
CAGGTCTAGGCCAGTCGCTGGTGGCAGCACGGCAAAGGCAAGTCCAGAACCCAAAGGTCCAATCACAAGAAGGAATTCAT
CTCCTATTGTGACTAGAGGAAGGCTCACTGAGACCCAAGGAAAAGGCCGTTATGGTAGTAATGGGCAGCAGCATCTTATA
GATGCACCTGAGCCCCGAAGGATTTCAAACGTGTCTGACATAACTTCACGGAGAACCGTGAGGACCTCGTCAACTGTCAC
AGACAATAACAACGGACTAGGCAGATCATTTTCAAAAAGTTCACTGGATATGGCCATTAGGCACATGGACATAAGAAATG
GGAAGACGAACGGTTGTGCACTATCAACCACAACACTATTCCCTCAGAGCATCAGACCAGCCTCATCCAAGATTCAGCCA
ATCCGTTCAGGGAATAATCATTCGGATTCAATCAGCAGCAACTGTACAGAGAACGGGAATGAAGCAAATGAGGGTAGAAG
ACTGATGGGGAAGTTGAGCGACATGGACATGTATGAGAGCTCAAGGTATGATGCATTGTTGTTGAAAGAAGACGTTAAGA
ACACAAACTGGTTGCATAGTATTGATGACCGGTCATCAGATCACGGACTCATGTTTGACAATGGAGGATTCGAGCTGCTT
CCAGAGCCCTTTGCCCCACTATAA