Details for Capsella Locus Carubv10013347m

Position : scaf_3 ( 5`- 7700943 .. 7703796 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013347m

Protein [Map View]
HFLLYCELSVSMLATAPVHGFRYVVPTRSWIQRLRCCSSSSSSLAPVSTSEFSGGNSIQKKVNEEKNSNGSNERTAPYYP
KRGQTVELVCESLGFKGKGICKVDGTGFVVMCDRALPGERFLGRVTRRKGSYAEVTKIKTISPHKDLVEAPCEYASYCGG
CKTQNLSYEAQLKAKEEQVHELIRHVGRFSDNSPSLEIVLKPIVACDIQFNYRNKMEFSFGPQRWLPVEMLNEREDGAKN
FALGLHAPGFFDKVLNVDKCLLQSEPGNVVLAAVQDCWRDPQLSLSPYDCRSHVGFLKHLMLRTGRNVETGSQELMVNFV
TSSYKPELLKPLVDRISSIPQVVSIMNNVNSSVGNTSVGEKEYTLYGKDTITEVLRGLTFQISANSFFQTNTHQAEVLYK
LIEESAGIKGDGSEVVLDLFCGTGTIGLTLARRAKHVYGYEVVPQAITDAHKNAQINGIENATFIQGDLNKIGEDFGNNF
PKPDIVISDPNRPGMHMKLIKFLLKLKSPRIIYVSCNPATCARDLDYLCHGVEEKNIKGCYKLMSVLPVDMFPHTPHIEC
ICLLELA*

DNA
CATTTTCTTCTATACTGCGAGCTCTCTGTTTCAATGTTGGCCACGGCGCCTGTTCATGGATTCAGGTACGTGGTTCCCAC
ACGCTCATGGATTCAGAGGTTGCGATGCTGCTCATCCTCTTCGTCTTCTCTAGCTCCTGTCTCTACTTCTGAATTCTCCG
GCGGTAATAGCATCCAGAAGAAGGTGAACGAAGAGAAGAACAGCAACGGAAGCAATGAGAGAACGGCGCCGTATTACCCC
AAACGAGGGCAGACAGTGGAGCTGGTGTGCGAGAGTTTGGGATTTAAAGGCAAAGGAATCTGTAAAGTTGATGGAACTGG
TTTCGTTGTTATGTGCGACCGAGCTCTTCCCGGCGAACGTTTTCTCGGCCGTGTCACTCGCCGCAAAGGCAGCTATGCTG
AGGTGACAAAAATCAAGACGATATCACCACATAAGGATTTAGTAGAAGCTCCATGTGAGTATGCATCCTATTGTGGTGGT
TGTAAGACTCAGAATCTCTCTTATGAAGCTCAGCTTAAAGCTAAAGAAGAGCAGGTTCATGAGCTTATTAGACATGTTGG
AAGGTTTTCTGATAACAGTCCTAGCCTTGAGATTGTCTTGAAGCCTATTGTTGCTTGTGATATCCAATTCAATTACCGGA
ATAAGATGGAGTTTTCATTTGGTCCACAAAGATGGCTTCCGGTTGAAATGTTGAATGAGAGAGAAGATGGTGCTAAGAAC
TTTGCATTGGGGTTACACGCACCTGGATTTTTTGACAAGGTTTTAAATGTCGATAAGTGCTTACTACAAAGCGAGCCAGG
AAACGTGGTTCTTGCTGCTGTCCAAGATTGCTGGAGAGATCCTCAATTAAGTCTTTCACCATATGACTGTCGTTCACATG
TTGGGTTTCTTAAACATTTGATGCTGAGAACTGGAAGGAATGTGGAGACGGGTTCACAAGAACTTATGGTCAATTTTGTG
ACATCATCTTACAAGCCAGAGCTGTTGAAGCCCCTGGTTGATAGAATTTCATCAATTCCTCAAGTGGTAAGCATCATGAA
TAATGTAAATTCTTCGGTCGGAAATACATCTGTTGGAGAAAAGGAATATACTCTTTATGGGAAAGATACAATCACAGAGG
TCTTACGAGGCCTTACATTTCAAATTTCAGCCAACTCGTTCTTTCAGACTAACACTCATCAGGCTGAAGTTTTATATAAG
CTTATTGAGGAATCAGCTGGAATTAAAGGAGATGGCTCAGAAGTCGTGCTCGATCTTTTCTGTGGAACTGGTACCATAGG
CCTTACACTTGCGAGAAGGGCAAAACATGTCTATGGTTATGAAGTAGTCCCACAAGCAATAACAGATGCACACAAGAATG
CCCAAATAAACGGCATAGAGAATGCAACATTCATCCAAGGAGATCTAAACAAAATAGGAGAAGATTTTGGGAACAATTTC
CCTAAGCCTGATATTGTCATTTCTGATCCCAATCGACCTGGTATGCACATGAAGCTGATCAAGTTTCTGCTAAAGCTTAA
ATCTCCACGGATCATTTATGTTTCCTGCAATCCTGCAACCTGCGCAAGGGATCTCGATTACCTCTGTCATGGCGTGGAGG
AGAAGAATATAAAGGGTTGCTACAAATTGATGAGTGTTCTGCCAGTGGATATGTTCCCTCACACTCCTCACATCGAGTGT
ATCTGCTTGTTGGAGCTTGCTTGA