Details for Capsella Locus Carubv10013346m

Position : scaf_3 ( 5`- 6520503 .. 6524291 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013346m

Protein [Map View]
MVESEKASVEELKKRIRKRTRGKKNEQQKPEEETHNVEEVLDEMQKKSGKKVKEVKLQGRGQIEEEVEAKEEGEEDKNNL
IVREGIMTNETFESLNLSEQTSKAMKEIGYLYMTQIQAGSIRPLIEGKDVLGAARTGSGKTLAFLIPAAELLYKERFSPS
NGTGVIVICPTRELAIQTKNVADELLKHHSQTVGMVIGGNNRRSEAQRLAKGANLLIATPGRLLDHLHNTKGFIYKHLKC
LVIDEADRILEENFEEDMNKILKILPKTRQTALFSATQTSKVKDLARVSLTSPVHVDVDDGRRKVTNEGLEQGYCVIPSE
KRLILLISFLKKNPKKKIMVFFSTCKSVQFHAEIMKISNVDVCDIHGGLDQNRRTKTFFDFMKAEKGIMLCTDVAARGLD
IPAVDWIVQYDPPDKPTEYIHRVGRTARGEGAKGKALLVLIPEELQFIRYLKAAKVPVKELELNEKMLMNVRSQLVKCVT
EDYNLNRLAKDAYRAYISAYNSHSLKDIFNVHRLDLQAVAASFCFSGPPKVNLNIESRAGKVRKARNQQGRSGFGPYSPY
GKSKPKDA*

DNA
ATGGTTGAATCGGAGAAGGCATCCGTTGAAGAGCTGAAGAAGAGGATAAGGAAGAGGACTCGTGGGAAGAAGAATGAGCA
GCAAAAACCGGAAGAAGAAACCCACAATGTAGAGGAAGTCTTAGATGAAATGCAGAAGAAGAGTGGAAAGAAGGTTAAGG
AAGTCAAGTTGCAAGGGAGAGGCCAAATCGAGGAAGAGGTGGAAGCAAAGGAGGAAGGCGAAGAAGATAAGAATAACTTG
ATTGTCAGGGAAGGGATAATGACTAACGAGACTTTTGAATCCCTCAACTTATCAGAGCAAACTTCAAAAGCTATGAAGGA
GATAGGATATCTTTACATGACGCAAATTCAAGCCGGATCTATTCGGCCTCTAATAGAGGGAAAAGATGTTCTCGGTGCTG
CCAGGACTGGTTCTGGTAAAACCCTTGCTTTTCTCATACCGGCTGCAGAGTTGCTGTATAAAGAGCGTTTCTCCCCTTCC
AATGGGACTGGTGTCATTGTTATTTGTCCCACAAGAGAGCTTGCTATTCAGACCAAAAATGTGGCGGACGAGCTACTCAA
GCATCACTCACAGACAGTCGGCATGGTTATTGGTGGCAATAACAGAAGGTCGGAAGCACAACGCCTTGCGAAAGGTGCAA
ACTTGTTGATAGCAACTCCGGGACGTCTTCTTGACCATCTTCACAATACAAAGGGTTTCATTTATAAACACCTGAAGTGC
CTTGTGATTGATGAAGCTGATAGGATACTGGAAGAGAATTTTGAGGAAGACATGAATAAGATTTTAAAGATTTTACCAAA
GACTAGGCAAACTGCGTTATTCTCTGCCACTCAGACTTCTAAGGTCAAAGATCTTGCTCGGGTGTCATTAACATCTCCTG
TTCATGTTGATGTCGATGATGGCAGACGCAAGGTGACGAATGAAGGATTGGAGCAAGGCTACTGTGTTATTCCGAGCGAA
AAAAGACTTATCCTTCTAATTTCCTTTTTGAAAAAGAACCCTAAAAAGAAAATCATGGTATTTTTCTCGACTTGCAAGTC
GGTACAATTCCATGCAGAAATCATGAAAATAAGCAATGTGGATGTTTGTGATATCCATGGAGGACTGGATCAGAATAGAA
GAACTAAAACCTTTTTCGACTTCATGAAAGCAGAAAAAGGTATCATGTTATGTACTGATGTTGCTGCCCGTGGTCTCGAT
ATTCCGGCTGTGGACTGGATTGTACAGTATGATCCTCCAGACAAGCCAACGGAATATATCCATAGGGTTGGTCGAACGGC
CCGTGGAGAAGGAGCAAAGGGAAAGGCTTTGCTTGTATTGATTCCTGAAGAGCTTCAGTTTATTCGCTACCTTAAGGCTG
CAAAAGTACCTGTTAAAGAGCTTGAGTTGAATGAGAAGATGCTAATGAATGTTCGATCTCAGCTGGTGAAATGTGTTACC
GAAGACTATAATCTGAACAGGTTAGCCAAGGATGCATACCGAGCTTATATCTCAGCATACAATTCACACTCTTTAAAAGA
CATCTTCAATGTTCACCGACTCGATCTCCAGGCGGTTGCAGCATCATTCTGCTTCTCTGGTCCACCTAAAGTGAATCTGA
ACATAGAAAGTAGGGCTGGGAAAGTGAGGAAAGCAAGGAATCAGCAAGGTCGCAGTGGCTTCGGCCCTTACAGTCCCTAT
GGCAAGTCCAAACCTAAAGATGCGTGA