Details for Capsella Locus Carubv10013344m

Position : scaf_3 ( 5`- 8246552 .. 8248496 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013344m

Protein [Map View]
MLSRVRISKLVSYTLPRRVFERRFLVTNNAFSNTEESTVVAAESPELPSWIRDFLSNKPSSSSSSLVPEDDEDFVIPSLA
NWVESQKFSREQVSEGNVVKKPVEDIEKVCEFLNKKDASHGDVVKELSGCDVVVTESLVLQVLRRFSNGWNKAYGFFIWA
NSQTGYRHSAKSYNAMVDVLGKCRNFDLMWELVDEMMKKSDESGLVTLDTMSKVMRRLAKSGKYSEAVEAFLGMEKSYGV
KTDTIAMNSLMDALVKENSIEHAHEVFLKLFDTIKPDARTFNILIHGFCKARKFDDARTMMDLMKVTEFTPDVVTYTSFV
EAYCREGDFRRVNEILEKMRENGSKPNVVTYTIVMHSLGKSKQVTEALGVYEKMKEDGCVPDAKFYSSLIHILSKTGRFK
DASEIFEDMTNQGVSRDVLVYNTMISAALHHSRDEMALRLLKRMVDEEEESCSPNVETYAPLLKMCCQKKKMKLLGILLH
HMVKNDVSIDVSTYILLIRGLCMSGKVEEACLFFEEAVRKGMVPRDSTCKMLVEELEKKNMAEAKLKIQSLVQSKTMTDL
GSPLSVVA*

DNA
ATGCTCAGTAGGGTTAGAATTAGTAAGCTTGTTTCGTATACTTTACCTCGGAGAGTCTTCGAACGGAGGTTTTTGGTGAC
GAACAACGCTTTCTCTAACACTGAGGAGTCGACGGTTGTTGCCGCAGAGTCGCCGGAGCTTCCGTCTTGGATCAGAGACT
TCTTATCAAACAAGCCTTCTTCTTCTTCTTCGAGTTTGGTTCCCGAAGACGATGAAGATTTCGTTATCCCATCTTTGGCG
AATTGGGTTGAGAGTCAGAAGTTTAGTCGTGAACAAGTCTCAGAGGGTAATGTGGTGAAGAAACCAGTGGAAGATATTGA
GAAAGTCTGCGAATTTTTGAATAAGAAGGACGCGTCTCATGGGGATGTTGTTAAAGAGTTGAGTGGATGTGATGTAGTGG
TTACAGAGAGTTTGGTTTTGCAAGTTCTGAGAAGGTTTAGTAATGGGTGGAATAAAGCTTACGGGTTTTTCATTTGGGCA
AATTCGCAAACAGGTTATAGGCATTCAGCGAAGAGTTATAACGCAATGGTTGATGTGTTGGGGAAATGTAGGAACTTTGA
TTTGATGTGGGAATTAGTTGATGAGATGATGAAGAAGAGTGATGAATCTGGGCTTGTTACGCTTGATACGATGAGTAAGG
TAATGAGGAGATTGGCGAAATCTGGGAAATATAGTGAAGCTGTTGAGGCGTTTTTAGGGATGGAGAAGAGTTATGGTGTT
AAAACAGATACTATTGCTATGAACAGTTTGATGGATGCACTTGTTAAAGAGAACAGTATAGAGCATGCTCATGAAGTGTT
TCTGAAGCTTTTCGATACAATCAAGCCGGATGCTCGGACATTCAACATTTTAATTCACGGGTTTTGTAAAGCTCGGAAAT
TTGATGATGCTAGGACAATGATGGATTTGATGAAGGTTACTGAGTTTACTCCTGATGTTGTTACGTACACAAGCTTTGTA
GAGGCTTATTGTAGGGAAGGAGATTTTAGGAGAGTTAATGAGATATTGGAGAAAATGAGAGAGAATGGGAGTAAACCTAA
TGTTGTGACTTATACGATCGTGATGCATTCTTTGGGAAAATCTAAACAAGTAACTGAAGCTTTAGGAGTTTATGAGAAGA
TGAAAGAAGACGGGTGTGTTCCTGATGCTAAGTTTTATAGCTCATTGATACATATTCTGTCAAAGACTGGTAGGTTTAAG
GACGCATCTGAGATATTTGAGGACATGACGAATCAAGGAGTTTCTCGTGATGTTTTAGTCTACAATACCATGATTTCTGC
AGCCCTTCATCATTCTCGAGATGAGATGGCCTTGCGTTTGCTTAAAAGGATGGTGGATGAAGAAGAGGAATCTTGCAGTC
CAAACGTTGAGACTTACGCTCCATTACTGAAGATGTGTTGCCAAAAGAAGAAGATGAAGCTACTTGGAATCCTGTTGCAT
CACATGGTGAAAAACGATGTCAGCATCGATGTGTCGACATATATCCTTCTCATTAGAGGATTGTGTATGAGCGGGAAAGT
TGAAGAAGCTTGCTTGTTCTTCGAGGAAGCGGTGCGGAAAGGAATGGTTCCTAGAGATAGCACTTGCAAAATGTTGGTGG
AGGAGCTTGAGAAGAAAAATATGGCAGAAGCAAAACTTAAGATCCAGAGTTTGGTTCAGTCGAAAACTATGACAGATTTA
GGCAGTCCTTTATCTGTTGTTGCGTAG