Details for Capsella Locus Carubv10013330m

Position : scaf_3 ( 5`- 7597842 .. 7602652 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013330m

Protein [Map View]
MARNKLVSGGGSHGIWKYFNPAFYLRRPRRLALLIILFVSVSMVVWDRQSLSRDYQVEVSKLNEEVVRLQQMLEEMKSVT
EDMSVKSLNDVQEDPVDAQRMQRVKEAMIHAWSSYETYAWGQDELQPQTKDGVDSFGGLGATMIDALDTLYIMGLDEQFQ
KARDWVASSLDFDKDYAASMFETTIRVVGGLLSAYDLSGDKIFLEKATDIADRLLPAWDTKSGIPYNIINLRHGNAHNPT
WAGGDSILADSGTEQLEFIALSQRTGDPKYQQKVEKVISVLNKDFPDDGLLPIYINPDTAKPSYSTTTFGAMGDSFYEYL
LKVWVFGNKTSAVKHYRDMWEKSMNGLLSLVKKSSPSSFTYICEKSGNSLIDKMDELACFAPGMLALGASGYSDPAEGKK
FLTLAEELAWTCYNFYQSTPTKLAGENYFFNSGNDMNVGTSWNILRPETVESLFYLWRLTGNKTYQEWGWNIFEAFEKNS
RIESGYVGLKDVNTGVKDNKMQSFFLAETLKYLYLLFSPTTVISLDEWVFNTEAHPLKINSRKYPVNRNQSNSVLQRKPA
FRIRQRHYGRITKK*

DNA
ATGGCGAGGAATAAACTTGTAAGTGGTGGTGGTAGTCATGGGATATGGAAATATTTCAACCCAGCATTTTATCTCCGACG
ACCAAGACGTCTTGCTTTGCTTATCATCCTCTTCGTCTCTGTTTCCATGGTTGTTTGGGATCGTCAGTCTCTTTCCCGCG
ACTACCAGGTTGAAGTTTCCAAATTAAATGAAGAAGTTGTGCGGTTGCAGCAGATGTTGGAAGAGATGAAAAGCGTCACT
GAGGATATGTCTGTGAAGAGTTTGAACGATGTCCAGGAAGATCCAGTTGATGCCCAGCGAATGCAGAGAGTTAAAGAAGC
AATGATTCATGCTTGGAGTTCTTATGAAACGTATGCTTGGGGACAAGATGAGCTTCAGCCCCAGACAAAAGATGGCGTTG
ACAGCTTTGGTGGTTTGGGAGCAACTATGATAGATGCGTTAGACACACTCTATATAATGGGTCTAGATGAGCAGTTTCAA
AAAGCCAGAGATTGGGTGGCAAGCTCATTAGATTTCGACAAGGATTATGCCGCCAGTATGTTTGAGACAACCATAAGAGT
GGTAGGAGGGCTTCTCAGTGCTTATGATCTTTCTGGGGATAAAATTTTCCTCGAAAAGGCTACTGATATTGCAGACAGAT
TATTGCCTGCATGGGACACTAAGTCGGGTATACCATATAATATTATCAACTTGAGACATGGAAATGCTCATAATCCTACA
TGGGCCGGGGGAGACAGTATTCTTGCCGATTCTGGTACTGAACAGCTCGAGTTTATTGCTCTTTCCCAGAGGACGGGTGA
CCCAAAGTATCAGCAAAAGGTAGAAAAGGTTATTTCAGTACTAAATAAGGATTTCCCTGATGATGGTCTACTTCCGATCT
ATATAAATCCCGATACAGCTAAACCATCATACTCTACCACGACATTTGGTGCCATGGGAGACAGCTTTTACGAATATTTG
CTCAAAGTTTGGGTGTTTGGGAACAAAACTTCAGCAGTGAAACACTATAGAGATATGTGGGAGAAATCAATGAATGGTCT
GCTAAGCTTGGTTAAGAAATCATCACCTTCGTCGTTTACATATATCTGTGAGAAGAGTGGAAATTCTTTGATCGATAAGA
TGGACGAATTAGCATGCTTTGCTCCCGGAATGTTGGCTTTAGGAGCATCTGGGTATAGTGATCCTGCTGAGGGAAAGAAG
TTTCTCACACTCGCGGAAGAGCTTGCATGGACATGCTATAATTTTTACCAATCGACACCAACAAAACTGGCTGGGGAGAA
TTATTTCTTCAACTCTGGGAATGACATGAATGTTGGAACGTCGTGGAACATCTTGAGACCAGAAACTGTTGAATCACTGT
TTTACCTCTGGCGGTTAACTGGCAACAAGACATATCAAGAGTGGGGATGGAATATATTTGAAGCGTTTGAGAAGAACTCG
CGTATAGAGTCTGGATATGTCGGTTTGAAAGATGTTAACACAGGCGTTAAGGACAACAAGATGCAAAGTTTCTTCCTTGC
TGAGACGCTCAAGTATCTCTACCTCCTCTTCTCACCCACAACAGTCATTTCCTTGGACGAATGGGTATTCAACACAGAAG
CTCATCCACTTAAGATTAATTCCCGTAAATATCCGGTAAATCGCAATCAATCCAACAGCGTGCTGCAAAGAAAACCGGCA
TTTAGAATACGCCAGAGGCACTATGGTCGGATAACAAAGAAGTAA