Details for Capsella Locus Carubv10013329m

Position : scaf_3 ( 5`- 2259536 .. 2262385 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013329m

Protein [Map View]
MVKRSKKSKSKRVTLKQKHKVLRKVKEHHKKKAKDAKKLGLNRKPRVEKDPGIPNDWPFKEQELKALEARRARALEEIEQ
KKVARKERAKKRKLGDDEDEDTKTEEETREDPTRVVNVRDNSERAFYKELVKVIELSDVILEVLDARDPLGTRCTDMERM
VMQAGPNKHLVLLLNKIDLVPREAAEKWLKYLREEFPAVAFKCSTQEQRSNLGWKSSKASKPSNMLQTSDCLGADTLIKL
LKNYSRSHELKKSITVGIIGLPNVGKSSLINSLKRAHVVNVGATPGLTRSLQEVHLDKNVKLLDCPGVVMLKSSGNDASI
ALRNCKRIEKLDDPVSPVKEILKLCPTQMLVTLYKIPSFEAVDDFLYKVATVRGKLKKGGLVDIEAAARIVLHDWNEGKI
PYYTMPPKRDQGGHAESKIVTELAKEFNIDEVYSGESSFIGSLKTVNEFNPVEVPSNGPLNFDETMIEDETTKTQTEEEA
DHDSGDESMGGEEEEKAGKAKEKSERGRQNVKLYSEESMLNTKKQKAEKKMRKKAKKAGGDEDLMEGDYDFKVDYKKDFQ
IDAKIPMDGLLPEE*

DNA
ATGGTGAAACGGAGTAAAAAGAGTAAGAGTAAGAGGGTGACCTTGAAGCAGAAGCATAAGGTTCTGAGGAAGGTGAAGGA
GCACCATAAGAAGAAGGCAAAGGATGCTAAAAAGCTTGGGCTTAACCGGAAGCCAAGAGTAGAGAAGGACCCAGGTATCC
CCAATGACTGGCCTTTTAAGGAACAAGAGCTCAAAGCCCTTGAAGCTCGACGTGCCCGTGCTCTCGAAGAGATCGAGCAG
AAAAAAGTCGCCCGCAAAGAAAGGGCCAAAAAAAGGAAGCTTGGTGATGATGAGGATGAGGATACCAAGACAGAAGAAGA
GACCAGAGAGGACCCAACTAGAGTTGTCAATGTTCGAGATAACTCGGAGAGGGCTTTCTACAAGGAGCTTGTTAAAGTCA
TTGAACTGTCTGATGTCATTTTGGAGGTTCTTGATGCCCGTGATCCCCTTGGCACTAGGTGTACTGACATGGAGAGGATG
GTTATGCAAGCTGGTCCCAATAAGCATCTTGTGTTGCTGTTGAACAAGATTGATCTTGTTCCCCGTGAGGCGGCTGAGAA
ATGGCTTAAGTACCTTAGGGAAGAATTTCCTGCTGTTGCATTCAAATGTAGTACCCAGGAACAGAGATCAAACTTGGGTT
GGAAATCATCTAAGGCATCAAAACCAAGCAATATGTTGCAGACTAGTGATTGTCTTGGAGCAGATACTCTTATCAAGTTG
TTGAAAAACTACTCAAGAAGTCATGAGTTAAAAAAATCTATTACAGTTGGTATTATTGGATTGCCTAATGTCGGGAAGAG
TAGTCTTATTAACAGTTTGAAGAGAGCTCACGTTGTCAATGTTGGTGCCACACCAGGACTGACTAGGTCTCTGCAAGAGG
TTCACTTGGATAAAAACGTGAAGTTGTTGGATTGTCCTGGAGTTGTGATGCTCAAATCATCAGGAAATGATGCTTCTATA
GCTCTCCGCAATTGTAAAAGAATCGAGAAGTTGGATGATCCAGTTAGTCCAGTTAAGGAAATTCTCAAGCTTTGTCCAAC
ACAAATGCTGGTAACTCTGTATAAAATCCCAAGCTTCGAGGCAGTTGATGATTTTCTTTATAAAGTCGCCACGGTAAGGG
GTAAGCTTAAAAAGGGTGGTCTTGTGGATATTGAAGCTGCTGCAAGAATTGTTTTGCATGACTGGAATGAAGGTAAAATC
CCATACTATACAATGCCCCCAAAGAGGGACCAAGGTGGACACGCAGAGTCAAAGATTGTGACCGAGCTGGCCAAGGAATT
CAATATAGATGAGGTTTACAGTGGTGAATCCTCTTTCATTGGGAGCTTGAAGACAGTTAACGAGTTCAACCCAGTTGAGG
TTCCTTCAAATGGTCCTCTCAATTTTGATGAAACTATGATCGAGGATGAGACTACTAAGACTCAGACAGAGGAAGAGGCT
GACCATGACAGTGGTGATGAGTCTATGGGAGGGGAGGAGGAGGAAAAGGCAGGAAAGGCTAAGGAGAAATCAGAGAGGGG
GAGGCAGAACGTTAAGCTATACTCGGAGGAAAGCATGTTGAATACAAAAAAGCAGAAAGCAGAGAAGAAGATGAGGAAGA
AAGCAAAGAAAGCAGGAGGTGATGAGGACCTGATGGAGGGAGATTATGATTTCAAAGTGGATTATAAGAAAGATTTCCAG
ATCGATGCTAAAATTCCGATGGATGGACTTTTGCCTGAAGAATGA