Details for Capsella Locus Carubv10013328m

Position : scaf_3 ( 5`- 4579264 .. 4583444 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013328m

Protein [Map View]
MSRLQKRGKQEKPLVSDGAEKVIVAVKASREIPKTALIWALTHVVQPGDCITLIVVVPSHNSGRKLWGFTRSFPMFAGDC
ASGHRKSHSEALPEIKSDLTDTCSQMILQLHDVYDPNKINVKIKIVSGSPCGAVAAESKKAQANWVVLDKHLKQEEKRCM
EELQCNIVVMKRSQAKVLRLNLVGSPRKDADKESPSPTGPEAASEKHPKNTKESLDSDRGLPVTPTSSPELGTPFTSTEA
GTSSVSSSDPGTSPFFTLGMNGYMKKDGALVIKENDLDDSGSETESENQSLASTSMRFQPWISEYISTHRQSSHEAEESL
WKNDDRAQISTTKALLEKFSKLDVEAGLSASRRIDMEFSGNLRDAISLSRSAPPGPPPLCSICQHKAPVFGKPPRLFSYA
ELELATGGFSQANFLAEGGYGSVHRGVLPEGQVVAVKQHKLASSQGDVEFCSEVEVLSCAQHRNVVMLIGFCIEDSRRLL
VYEYICNGSLDSHLYGRQKETLEWPARQKIAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDNEPLVGDFGLARWQP
DGELGVDTRVIGTFG*

DNA
ATGAGTCGACTTCAGAAGCGAGGGAAGCAGGAAAAGCCTCTTGTATCTGATGGAGCTGAAAAGGTTATTGTGGCTGTTAA
AGCGTCTAGGGAGATTCCAAAGACAGCCTTGATTTGGGCTCTGACTCATGTCGTTCAGCCTGGGGATTGCATTACCCTCA
TTGTTGTTGTTCCTTCTCACAACTCTGGACGGAAACTCTGGGGTTTCACTAGGAGTTTCCCTATGTTTGCTGGGGATTGT
GCAAGTGGTCATCGGAAATCACATTCTGAAGCACTACCTGAGATAAAGAGTGATCTCACTGACACTTGTTCCCAAATGAT
TCTCCAGCTTCACGATGTTTATGATCCGAATAAGATCAATGTGAAGATTAAGATTGTTTCTGGATCACCCTGCGGAGCAG
TTGCTGCTGAGTCGAAGAAAGCGCAAGCAAACTGGGTAGTACTGGACAAACACCTCAAGCAGGAAGAGAAACGGTGTATG
GAGGAATTGCAGTGTAACATTGTAGTAATGAAACGTTCTCAGGCAAAAGTTCTACGCTTAAACTTGGTTGGATCGCCTAG
GAAGGATGCTGACAAAGAGTCTCCTTCACCAACTGGACCAGAAGCAGCATCTGAAAAACATCCAAAGAACACGAAAGAAT
CCCTAGATTCTGATAGAGGCCTACCTGTTACTCCTACTAGCAGCCCTGAGCTGGGGACACCATTCACAAGTACAGAAGCC
GGGACTTCATCAGTGTCGAGCTCTGACCCGGGAACTTCACCTTTTTTCACATTGGGAATGAACGGATACATGAAGAAGGA
TGGAGCATTGGTCATCAAGGAGAATGATCTTGATGATTCTGGCTCTGAAACAGAAAGCGAGAATCAGTCATTAGCGTCGA
CGAGTATGAGATTTCAGCCATGGATATCAGAATATATTAGCACTCATCGCCAGTCATCTCATGAGGCCGAAGAAAGCCTT
TGGAAAAATGATGATAGGGCACAAATATCCACTACAAAGGCTTTGCTGGAAAAGTTCTCTAAACTTGATGTAGAAGCTGG
GTTGTCGGCTAGTCGAAGGATTGATATGGAGTTTAGTGGAAACCTAAGAGATGCAATATCACTCTCTCGAAGTGCTCCGC
CTGGTCCGCCTCCTCTCTGTTCTATCTGCCAGCACAAGGCGCCAGTATTTGGGAAACCTCCAAGACTGTTTTCATACGCT
GAGTTAGAGCTTGCAACAGGTGGGTTTTCACAGGCTAACTTTTTGGCTGAGGGTGGTTATGGATCTGTTCATCGGGGTGT
TCTACCAGAAGGCCAGGTAGTTGCAGTTAAGCAACACAAACTGGCCAGTTCTCAAGGAGATGTAGAGTTTTGCTCCGAAG
TGGAAGTTCTCAGCTGTGCTCAGCACAGAAATGTTGTTATGCTAATTGGTTTCTGCATTGAAGACAGCAGACGGCTCTTG
GTCTACGAATACATATGCAACGGTTCACTTGATTCCCATCTATACGGTCGCCAAAAGGAAACTCTGGAGTGGCCAGCACG
GCAAAAGATTGCCGTTGGAGCTGCAAGAGGTCTTCGGTATCTTCACGAAGAGTGCAGAGTTGGCTGTATTGTCCACCGAG
ACATGCGTCCTAACAACATCCTCATCACTCATGATAATGAGCCACTGGTTGGAGATTTTGGTCTTGCGAGATGGCAGCCT
GATGGGGAACTGGGTGTAGATACACGAGTGATAGGAACGTTCGGGTGA