Details for Capsella Locus Carubv10013326m

Position : scaf_3 ( 5`- 5268017 .. 5271469 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013326m

Protein [Map View]
MGAQIVLCDGFEVVPPPEMNDLSLFGSDHSVSYCDVSTVTTEEDGNVFSGDSSPGVAAGEWAFSFYFVKHPVYDDPEIKA
KIDEADQEIYRCNKLRIDVSNAQKFERGLGPKSEGYRLVFEEKKREFDTLQETLRKFRCSNSDQLCFTKEELDHLIYIAH
YQIEHGSVGLEDEDWMLKDVEKPDGIILSEDSLALKEVSVNRVKSMAVELNEVKKELDAITWKINQLADKMGKSQNNIRI
LDLEMAHILEKRDKLYGRIKMLRIQRDKGNAAYFQSLAVMRKAKELAASGNVSDLEVLSSSEVDRFMTHWNNDKAFRDDY
VKRISLSLGERELNRDGRTKDPAVLVVREKQVLSKTIVVGEKVHKANKEDSNSNSSQDGNVTTDKRKKEMKKIDSNRSSA
EERDVIDLEFPVYEKPKKEEEEVDEETLKERKREEQLEKARLAMERKRKLQEKAAAKAAIRAQKEAEKKLKECEKKAKKK
AAANSSSPLESDQSREVINELEKVKTVTVSGKEKHQKDRSLFPKQRSFRYKHRGRGTEALPKAILNRRRAHKYWVWGLSS
AALACALFLVVLLLR*

DNA
ATGGGTGCGCAGATTGTACTCTGTGACGGCTTCGAGGTGGTTCCTCCGCCGGAAATGAACGATTTGTCTCTCTTCGGAAG
CGACCATTCTGTCTCATATTGCGATGTATCAACTGTCACCACCGAAGAAGACGGCAATGTTTTTTCCGGCGATAGTTCAC
CGGGAGTTGCAGCTGGAGAGTGGGCTTTCTCTTTCTACTTTGTTAAGCATCCGGTTTATGATGATCCCGAGATCAAAGCT
AAGATCGATGAAGCTGATCAAGAGATTTATCGCTGTAATAAGCTCCGAATTGATGTCTCCAATGCACAAAAATTCGAAAG
GGGTTTGGGTCCTAAGTCGGAAGGCTATAGATTGGTTTTTGAAGAGAAGAAGAGGGAATTTGATACTCTACAGGAAACTC
TACGGAAGTTCCGGTGCTCCAATAGCGATCAGCTTTGCTTTACAAAGGAGGAGCTCGATCATCTTATTTACATAGCTCAT
TATCAGATTGAACATGGTAGCGTTGGTTTGGAAGATGAAGATTGGATGCTTAAGGATGTTGAGAAGCCTGATGGGATAAT
TCTAAGTGAGGATTCTCTTGCGCTGAAAGAAGTTTCCGTAAACCGTGTCAAGTCAATGGCTGTGGAACTGAATGAAGTAA
AGAAGGAGCTCGATGCCATTACATGGAAGATTAACCAGTTGGCTGACAAGATGGGAAAGAGCCAGAACAATATCAGGATT
TTGGATTTAGAAATGGCACACATACTTGAGAAGAGGGACAAGTTGTATGGAAGGATTAAGATGCTGAGGATACAACGAGA
CAAAGGGAATGCCGCCTATTTCCAGAGCCTTGCTGTTATGAGGAAAGCTAAAGAATTGGCTGCTTCTGGAAATGTTAGTG
ACCTTGAAGTGTTGTCCAGCTCTGAGGTTGATAGGTTCATGACTCATTGGAATAATGACAAGGCTTTCAGGGATGATTAC
GTAAAAAGAATCTCACTTTCACTCGGTGAAAGAGAGCTGAATCGAGATGGCCGGACTAAAGATCCTGCAGTTCTTGTTGT
CCGGGAAAAGCAAGTGCTGAGTAAGACTATTGTGGTAGGCGAGAAGGTTCACAAGGCGAACAAAGAAGATTCCAACTCCA
ACTCGTCTCAAGATGGGAATGTAACTACAGATAAACGAAAGAAAGAAATGAAGAAAATAGATAGCAACAGGTCTAGTGCT
GAGGAGCGTGATGTTATAGATTTGGAATTCCCCGTGTATGAGAAACCGAAGAAGGAAGAAGAAGAGGTCGATGAAGAAAC
GTTGAAGGAGAGGAAGAGAGAAGAGCAGTTAGAGAAAGCTCGGTTAGCCATGGAAAGGAAGAGGAAGCTGCAAGAAAAAG
CTGCTGCGAAAGCTGCCATAAGAGCTCAAAAGGAAGCTGAAAAGAAACTCAAGGAGTGTGAGAAGAAGGCAAAGAAGAAA
GCTGCTGCAAATTCTTCTTCTCCTTTAGAATCAGACCAGTCACGAGAAGTAATCAATGAGCTGGAAAAGGTTAAGACTGT
GACAGTTTCAGGGAAAGAGAAACACCAAAAGGATAGATCATTGTTTCCAAAGCAAAGAAGTTTCAGGTACAAACACCGCG
GAAGAGGAACCGAAGCTCTGCCTAAGGCCATCCTGAACCGTAGAAGGGCTCATAAATATTGGGTCTGGGGACTTTCTTCT
GCTGCACTTGCTTGCGCACTCTTTCTCGTGGTTTTACTTCTACGGTAA