Details for Capsella Locus Carubv10013322m

Position : scaf_3 ( 5`- 1254602 .. 1259102 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013322m

Protein [Map View]
MAEAEDQQNFVAHNGDQVPDQGLDEVHNGIPYQGHDETIGHQQYEVQDPILEPPQYVVQDQTLEPQQYEVQDQLEYQGYQ
GQDQAHEEVQDQPQDDLQYQPQDQPQDDLQYQPQNQEQYQLQDEAHDQAHYQVEGETQDHNGNEVQDKVEDEEGIPEHLE
SLEKSEPEEGAAVGGEEKRWPGWPGETVFRMLVPAQKVGSIIGRKGDVIKKIVEETRARIKILDGPPGTTERAVMVSGKE
EPESSLPPSMDGLLRVHMRIVDGLDGEASQAAPASKVSTRLLVPASQAGSLIGKQGGTVKAIQEASSCIVRVLGSEDLPV
FALQDDRVVEVVGEPTSVHKALELIASHLRKFLVDRSIIPFFENQMQKPTRQMDHMPPPHQAWGPPQGHAPSSGPGGYGH
NAPAYMQPPPRHDSYYPPPEMRPPQMEKQPHQGISAYGREPPMNVHVSSAPPMVAQQVTQQMQIPLSYADAVIGTSGSNI
SYTRRLSGATVTIQETRGVPGEMTVEVSGTGSQVQTAMQLIQNFMAEAGAPAPAQPQTVAPEQQGYNPYATHGSVYAPAP
TNPPGGYATDYSSGYGY*

DNA
ATGGCTGAAGCTGAAGATCAGCAAAATTTTGTTGCACATAATGGAGATCAGGTACCAGATCAAGGGTTAGACGAGGTGCA
TAATGGGATACCGTACCAGGGCCATGATGAGACCATTGGTCACCAACAATACGAGGTTCAAGATCCGATTCTTGAACCTC
CACAGTACGTTGTACAAGATCAGACTCTTGAACCCCAGCAGTACGAGGTTCAAGATCAATTAGAGTATCAAGGATACCAG
GGGCAGGACCAGGCTCATGAAGAAGTCCAAGATCAGCCGCAAGATGACCTACAATATCAGCCACAAGATCAGCCGCAAGA
TGACTTACAATACCAGCCTCAAAATCAGGAGCAGTATCAGTTGCAAGACGAGGCTCATGATCAGGCCCACTATCAGGTGG
AAGGTGAGACACAAGATCACAATGGTAATGAAGTGCAAGATAAAGTAGAAGATGAGGAAGGAATTCCTGAGCATCTTGAG
TCTTTAGAGAAATCAGAGCCTGAAGAAGGTGCAGCAGTTGGAGGTGAGGAGAAGAGGTGGCCGGGATGGCCCGGAGAAAC
GGTGTTCCGCATGCTGGTTCCTGCACAAAAAGTGGGTAGTATCATTGGTCGCAAAGGTGACGTCATTAAGAAAATAGTTG
AGGAGACAAGGGCTCGAATAAAGATTCTTGATGGTCCTCCAGGCACAACCGAAAGAGCTGTTATGGTTTCTGGTAAAGAA
GAGCCCGAATCATCTCTACCACCTTCTATGGATGGCCTTCTTAGAGTCCACATGCGGATAGTTGATGGTTTGGATGGTGA
AGCTTCTCAGGCCGCTCCGGCTTCGAAGGTGTCAACAAGATTACTAGTCCCAGCATCTCAGGCTGGAAGTTTGATTGGAA
AACAAGGAGGAACAGTTAAAGCTATTCAGGAAGCATCCAGTTGTATAGTCCGAGTTCTTGGATCAGAGGATTTGCCTGTT
TTTGCCCTTCAAGACGATAGGGTTGTTGAAGTTGTGGGGGAACCAACAAGTGTTCATAAAGCCTTGGAGCTGATTGCGTC
ACATCTCAGAAAGTTCTTGGTTGATCGTAGCATCATCCCATTCTTTGAAAATCAGATGCAAAAGCCAACTCGCCAGATGG
ATCATATGCCACCACCGCACCAGGCATGGGGTCCTCCTCAAGGTCATGCACCAAGTAGTGGGCCAGGAGGCTATGGTCAC
AACGCACCTGCATATATGCAACCACCTCCTAGACATGATAGTTACTATCCTCCTCCTGAGATGCGTCCACCTCAAATGGA
GAAACAGCCTCATCAAGGTATATCTGCATATGGGAGAGAGCCTCCTATGAATGTGCACGTATCGTCTGCTCCACCTATGG
TCGCTCAGCAAGTTACACAGCAAATGCAGATTCCATTGTCTTACGCAGATGCTGTAATTGGGACATCAGGTTCAAACATA
AGCTACACAAGACGTCTTAGTGGAGCAACGGTAACCATTCAGGAAACGAGGGGAGTACCTGGTGAAATGACCGTTGAGGT
TAGCGGAACTGGCTCACAAGTCCAAACTGCTATGCAGCTTATTCAGAACTTCATGGCTGAAGCTGGAGCGCCGGCACCAG
CACAGCCTCAAACTGTAGCACCAGAGCAGCAAGGCTATAACCCATACGCAACACATGGCTCAGTCTACGCACCGGCTCCA
ACAAACCCACCTGGAGGATACGCTACGGACTACAGCTCAGGCTACGGTTACTGA