Details for Capsella Locus Carubv10013320m

Position : scaf_3 ( 5`- 5206318 .. 5208695 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013320m

Protein [Map View]
MVTLREPYLFSQKWGVTIHGLCLKIGSEMMVEVGNSLLDMYSKCGKINEAERVFRWMVDRSLISWNAMIAGYVHAGYGSK
ALATFGMMQEENMKERPDEFTLTSLLKACSSTGMIHAGKQLHGFLVRSGFHCPSSATISGSLVDLYVKCGNLFSAQQAFD
QIKEKKMISWSSLILGYAQEGEFVEAMGMFKRLQELNSQIDSFVLSSIIGVFADFALSQQGKQMHALAVKLPSGLETSVS
NSVVDMYFKCGLVDEAEKCFAEMQSKDVISWTVMITGYGKHGLGKKAISIFNKMLRHNIDPDEVCYLAVLSACSHSGMIN
EGEELFSKLLETQGIKPRVEHYACVVDLLGRAGRLKEAKHLIDTMPIKPNVGIWQTLLSRCQVHGDMELGKEVGKILLWI
DGKNPANYVMMSNLYGQAGYWNEQGNTRELGNVKWLKKEAGMSWVEIEREVHFFRSGEDSHPLTLLIRETLKEVERRLRE
ELGYVYGLKHELHDIDDESKEDNLRAHSEKLAIGLALASGGLNQKGNTIRVFKNLRVCVDCHEFIKAVSKITKIAFIVRD
AVRFHSFEDGCCSCGDYW*

DNA
ATGGTGACCTTACGGGAACCTTATCTCTTTTCACAGAAATGGGGCGTCACGATCCATGGGCTTTGTTTGAAGATTGGCTC
TGAAATGATGGTTGAGGTGGGAAATTCTTTACTTGACATGTATTCCAAATGTGGAAAAATCAACGAAGCTGAGAGAGTGT
TTCGTTGGATGGTGGATAGGAGTCTTATAAGCTGGAACGCGATGATAGCTGGATATGTACATGCGGGGTATGGTAGTAAA
GCTTTGGCAACGTTTGGGATGATGCAAGAGGAAAATATGAAGGAAAGACCTGACGAGTTCACTTTGACTAGCTTGTTGAA
GGCTTGCAGTAGCACTGGTATGATTCATGCAGGAAAACAGTTACATGGTTTTCTAGTTAGGAGTGGGTTCCATTGTCCAA
GTTCCGCAACCATCTCTGGTTCTCTTGTTGATTTGTATGTCAAGTGTGGAAATCTCTTTAGTGCTCAGCAAGCTTTTGAT
CAAATCAAGGAAAAGAAAATGATCTCATGGAGTTCATTGATTCTTGGATATGCTCAAGAGGGTGAATTCGTGGAGGCGAT
GGGTATGTTTAAGCGACTACAGGAGCTAAACTCTCAGATCGACAGTTTTGTTCTTTCTAGCATCATTGGAGTCTTTGCTG
ATTTTGCCCTCTCGCAGCAAGGGAAGCAAATGCATGCACTTGCTGTTAAACTTCCATCTGGGCTAGAAACATCTGTTTCG
AATTCAGTGGTGGACATGTATTTCAAGTGTGGATTAGTTGATGAGGCTGAGAAATGCTTTGCCGAAATGCAGTCGAAAGA
TGTGATCTCCTGGACTGTAATGATCACTGGCTATGGGAAGCACGGGCTTGGCAAAAAAGCTATTAGTATTTTTAACAAAA
TGTTGAGACATAACATTGATCCTGATGAGGTATGCTATTTAGCTGTACTCTCAGCTTGTAGCCATTCTGGTATGATCAAT
GAAGGTGAAGAACTTTTTTCGAAGTTACTTGAGACACAGGGAATTAAACCTAGGGTAGAACACTATGCATGTGTTGTTGA
TCTATTAGGACGAGCTGGTCGTTTGAAGGAAGCTAAACATCTGATTGACACAATGCCTATTAAACCAAATGTCGGGATAT
GGCAAACACTTCTTAGCCGCTGTCAAGTACATGGGGACATGGAACTAGGGAAAGAAGTGGGAAAGATTCTTTTGTGGATC
GATGGAAAGAATCCTGCAAATTACGTGATGATGTCCAACCTTTATGGCCAAGCTGGTTATTGGAACGAACAAGGGAACAC
ACGAGAGCTTGGGAATGTAAAATGGTTGAAGAAAGAAGCTGGTATGAGCTGGGTCGAGATTGAGAGAGAGGTACATTTTT
TCCGTAGTGGAGAGGATTCACATCCTCTGACACTTCTGATCCGAGAAACTTTGAAAGAAGTTGAAAGAAGACTAAGAGAA
GAACTGGGATATGTTTACGGCCTGAAACATGAGCTGCATGATATAGATGATGAGTCGAAGGAGGATAACCTTAGAGCTCA
CAGCGAAAAGCTAGCTATTGGTCTGGCATTGGCATCAGGCGGGTTAAACCAGAAAGGAAACACAATAAGAGTGTTCAAGA
ACTTGAGGGTATGCGTGGATTGTCATGAGTTCATCAAGGCGGTGTCTAAAATCACGAAAATAGCTTTCATTGTGAGAGAT
GCTGTTCGGTTTCACAGTTTTGAAGATGGGTGTTGTTCCTGTGGAGATTACTGGTGA