Details for Capsella Locus Carubv10013311m

Position : scaf_3 ( 5`- 2289348 .. 2292600 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013311m

Protein [Map View]
MASLVRSWIPLLVLQSFLFAIAFGSTQVEEFSEALLLKPLPDRKVLAHFHFENRAPPSNSHGRHHHLFPKAISQLVQKFR
VKEMELSFTQGRWNHEHWGGFDPLSSMNAKPVGVELWAVFDVPQSQVDTSWKNLTHALSGLFCASINFLESSTSYAAPTW
GFGTNSDKLRYGSLPREAVCTENLTPWLKLLPCRDKDGISALMNRPSVYRGFYHSQRLHLSTVESGQEGLGSGIVLEQSL
TVVLQPDTTSIETNIQPSWSLSSLFGRKVVGRCVLANSSHVYLQLEGRLGQESKNVDTEIEAHKLWKNADFELSFKPDRV
LRESSSFLFIFDIDNASDSEPFDLGLTWKVPSKWSCQQAPLHASRFLMGSGNERGAIAILLKATESQESSPVRELTDGRC
TIKANVFQIFPWYIKVYYHTLQIFVDQQLKTDSEVLKKINVSPSTDKVSSGMLEIMLELPCEVKSAAISIEYDKGFLHID
EYPPDANQGFDIPSALISFPNHHASLDFQEELSKSPLISSFKEKSLVRSYTEVLLVPLTTPDFSMPYNVITITCTIFALY
FGSLLNVLRRRIGEEERFLKSQG*

DNA
ATGGCTAGCCTTGTTCGATCCTGGATCCCTTTGTTAGTTTTGCAATCGTTTTTGTTTGCGATCGCTTTTGGATCGACACA
AGTCGAAGAATTCAGCGAAGCATTGCTGTTGAAGCCTTTGCCTGATCGAAAAGTTTTAGCTCACTTCCATTTCGAGAACC
GAGCTCCTCCCTCGAATTCCCATGGCCGCCATCACCATCTCTTCCCAAAAGCTATTTCTCAGTTGGTTCAGAAATTCCGG
GTCAAGGAGATGGAACTATCTTTTACTCAGGGTCGTTGGAACCATGAACATTGGGGAGGATTTGACCCTCTATCAAGTAT
GAATGCAAAGCCCGTTGGGGTCGAGCTATGGGCTGTGTTTGATGTTCCTCAGTCTCAGGTTGACACTTCTTGGAAGAACT
TAACTCATGCACTTTCAGGGCTTTTCTGTGCTTCCATCAACTTTCTTGAATCTTCCACTTCTTATGCTGCTCCTACATGG
GGATTTGGGACAAATTCAGACAAGCTGAGGTATGGTTCACTGCCACGTGAAGCTGTTTGTACTGAGAACTTGACCCCATG
GCTAAAACTGCTTCCATGTAGAGACAAGGATGGCATTTCTGCACTAATGAATAGGCCATCTGTTTACAGAGGCTTTTATC
ATTCTCAGAGATTGCATTTATCCACGGTTGAATCTGGTCAAGAGGGATTGGGTTCTGGCATAGTGCTGGAGCAATCTCTT
ACTGTTGTTCTTCAGCCTGATACTACTTCTATTGAAACAAATATACAACCCAGTTGGTCCCTTAGCTCCCTCTTTGGGCG
AAAAGTAGTTGGGAGATGTGTTCTTGCAAATTCAAGTCATGTGTATCTTCAGTTGGAGGGTCGTCTTGGTCAGGAATCAA
AGAACGTGGATACAGAGATAGAAGCACACAAACTCTGGAAGAACGCAGATTTTGAATTGTCCTTTAAGCCAGACAGGGTT
CTTCGAGAAAGCAGCAGTTTTCTCTTTATCTTTGATATTGACAATGCTAGTGACAGTGAGCCATTTGATCTTGGCCTTAC
TTGGAAAGTTCCCTCAAAGTGGTCATGTCAACAAGCTCCATTGCACGCAAGTCGTTTTTTGATGGGGAGTGGCAACGAAA
GGGGCGCAATAGCCATCTTGTTAAAAGCGACAGAATCGCAGGAGAGTTCACCTGTCAGAGAACTCACTGATGGACGCTGT
ACAATAAAAGCAAATGTTTTCCAGATTTTCCCATGGTATATTAAGGTTTACTATCATACCTTACAAATTTTTGTGGATCA
ACAACTGAAGACAGACAGTGAAGTCTTAAAGAAGATCAATGTCTCACCATCTACTGATAAGGTGTCATCTGGCATGTTGG
AGATAATGCTGGAACTACCATGTGAAGTGAAATCTGCAGCCATATCAATCGAATATGATAAGGGTTTTCTACATATAGAT
GAATATCCCCCTGATGCTAATCAAGGATTTGACATTCCATCGGCTTTGATAAGCTTTCCCAATCATCATGCTAGTTTAGA
TTTTCAAGAAGAACTCAGCAAATCGCCCTTAATATCAAGTTTTAAGGAAAAATCCTTAGTTCGTTCTTACACAGAAGTAT
TGCTCGTCCCTTTGACAACTCCTGATTTTAGCATGCCCTACAATGTAATCACAATCACATGCACCATCTTCGCATTGTAT
TTTGGATCATTGCTCAATGTTTTACGTAGACGAATCGGTGAAGAAGAAAGGTTTCTCAAAAGCCAAGGTTAG