Details for Capsella Locus Carubv10013295m

Position : scaf_3 ( 5`- 6180339 .. 6184888 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013295m

Protein [Map View]
MVFAAKKFINNPSDVVTEFIEGLVETYPGLQYLDGFPEVKVVLRADVAAEKYDKVAIISGGGSGHEPAHAGYVGEGMLTA
AICGDVFASPPVDSILAGIRAVTGTEGCLLIVKNYTGDRLNFGLAAEQAKSEGYKVETVIVGEDCALPPPRGIAGRRGLA
GTVLVHKVAGAAAEAGLSLEKVAAEAKCASEMIGTMGVALSVCTLPGQVTSDRLGAEKMELGLGIHGEPGAAVVDVQPVD
VVVSHVLKQILNPETNYVPITRGNRVVLMVNGLGGTPLMELMIATGKAVPKLQLEFGLAVDRVYTGFFMTSLDMAGFSIS
IMKADQSILDRLDAPTKAPNWPVGSDGNRPPPKIHVPVPPSLSVKAESQSRPHELSKEGRILEAAIQAAATVIISLKDSL
NEWDGKVGDGDCGSTMYRGATAILEDMKNYYPLNDAAETVNEIGSSVRRAMGGTSGIIYHLLCKAAYAELKAKAQSDITP
KHWSEALKSSITSVSKYGGATAGYRTMLDALIPASQVLEEKLSAGEDPIAAFILSAEAATAGAESTIQMQAQAGRSSYVS
AEILATVPDPGAMAAAGWFSAAARAVKEQYQS*

DNA
ATGGTTTTCGCGGCCAAGAAATTCATCAACAACCCCAGCGATGTTGTAACTGAGTTCATCGAGGGTCTCGTCGAGACTTA
TCCTGGACTGCAGTATTTGGATGGATTTCCTGAGGTTAAGGTGGTATTACGAGCTGATGTCGCGGCTGAAAAATATGATA
AGGTTGCCATTATATCAGGTGGAGGGAGTGGGCATGAGCCTGCACATGCTGGGTACGTTGGAGAAGGTATGCTAACAGCA
GCTATCTGCGGAGATGTCTTTGCCTCCCCACCAGTTGATTCCATCCTTGCCGGAATTCGAGCTGTAACTGGTACTGAGGG
ATGTCTCTTGATAGTCAAGAATTATACTGGTGATCGCTTGAACTTTGGTTTGGCTGCTGAACAAGCAAAATCTGAAGGTT
ACAAAGTTGAGACGGTCATTGTTGGAGAGGATTGCGCATTACCCCCGCCACGTGGTATTGCTGGACGCAGAGGGTTAGCA
GGAACAGTTCTTGTCCATAAGGTTGCGGGTGCTGCAGCAGAGGCTGGTCTTTCTCTAGAAAAAGTTGCGGCTGAGGCAAA
ATGTGCATCCGAGATGATTGGTACCATGGGTGTTGCATTATCCGTCTGTACGCTTCCTGGACAGGTTACATCAGATCGTC
TTGGCGCAGAAAAGATGGAACTCGGGCTTGGAATTCATGGAGAACCTGGTGCTGCGGTGGTAGACGTTCAACCTGTGGAT
GTGGTGGTTTCCCATGTTCTTAAGCAGATACTTAATCCTGAGACCAATTATGTTCCAATTACTCGTGGTAACAGAGTGGT
TCTCATGGTTAACGGCTTGGGAGGCACCCCTTTAATGGAACTTATGATTGCTACTGGAAAGGCAGTCCCTAAACTGCAGT
TGGAATTCGGACTTGCTGTTGATAGGGTGTATACAGGCTTTTTTATGACTTCTCTTGATATGGCAGGATTCTCTATTTCA
ATCATGAAGGCTGACCAGTCAATTTTAGACCGATTGGATGCTCCAACCAAGGCTCCAAATTGGCCTGTGGGCAGTGATGG
CAACAGGCCACCACCAAAGATTCATGTTCCTGTTCCTCCTTCTCTATCGGTAAAAGCCGAGTCTCAAAGCCGACCTCATG
AGCTGAGCAAAGAAGGTCGAATCCTTGAGGCAGCTATTCAAGCAGCAGCAACTGTGATCATTAGTCTAAAGGATAGTTTG
AACGAATGGGATGGAAAAGTTGGCGATGGTGATTGTGGATCAACAATGTACAGGGGTGCAACAGCTATTCTGGAGGACAT
GAAAAATTATTATCCACTCAATGATGCTGCAGAGACAGTTAATGAGATTGGTTCATCAGTCAGAAGAGCCATGGGGGGGA
CAAGCGGAATAATTTACCATCTCCTCTGCAAGGCAGCATACGCGGAGCTAAAAGCTAAGGCTCAGTCAGATATCACTCCT
AAACACTGGTCTGAAGCACTCAAATCATCAATCACTTCAGTCAGCAAGTATGGTGGAGCAACTGCAGGCTACCGAACAAT
GCTAGATGCTCTCATCCCAGCTTCACAAGTCCTTGAGGAGAAGCTGAGTGCAGGAGAAGATCCGATAGCTGCTTTCATTC
TGTCAGCTGAAGCAGCAACTGCAGGAGCGGAATCAACCATACAGATGCAAGCACAGGCTGGGAGATCAAGCTATGTATCT
GCAGAGATTCTTGCAACGGTTCCAGATCCAGGTGCAATGGCTGCAGCAGGATGGTTTAGTGCCGCAGCAAGAGCCGTGAA
GGAGCAGTATCAGAGCTGA