Details for Capsella Locus Carubv10013278m

Position : scaf_3 ( 5`- 8201901 .. 8206077 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013278m

Protein [Map View]
MSAPFYSSIDIQEIVQNPPGFDSEPVPISTYHDTEPVPLSTYRENDSDDLDSTQQEKDDFWENGFNREEAIDDPEPSQAK
ENGKRSVDNSSFTHGKTDLNQLPAIPPVSTGQGLPYAPVDWPSPGDVWTWRVGRRVTATGYHQDRFLILPQRLQQKNVPK
SFASKVHLGRYIQSNFPGMDADAFLSSFSWKIPALFQPANKVDAASLFEETPKEVQSEVGQNDDAQVGKKEGNSRYSQRK
RKPMPTQTYEPVEAKPKPTPRASSKKKKGATTPGTGPQSTPKPKSSRQSARRASNQQRGGAVNLNFQNEEGEPATAPNTS
NKRKKRGANYEEEDVSIPHIYVSPMNGVLAVSHSPIDVNPEEFDSYLNSLDNLMQQPPEEVGGDSSVLVSVSSPMREYEW
AEARMKISSLLEKDFTTLFLSKDATEIAALATKLRKDPNLSAEEIVRLKLMEEIPTFSEVFQENKGVIEEADRFFSALEL
NKAKVASLKYEYSDLREKLGSIQMEVDSNSETIRQIDDQIAQLQARRSELKRYIGTKEKERVDLSYGQKMVANSIPKVVQ
EVQSANSKKHEWECKKDNALKREAEILSKFTSLKGFFF*

DNA
ATGTCTGCTCCGTTTTATTCTTCGATAGATATACAAGAGATCGTTCAAAATCCTCCTGGGTTTGATTCGGAGCCAGTCCC
AATCAGTACTTACCATGACACTGAACCTGTCCCGCTTTCAACTTACCGAGAAAATGATTCAGATGATCTCGACTCCACTC
AGCAAGAGAAAGACGACTTCTGGGAAAACGGTTTCAACAGAGAAGAGGCCATTGACGATCCAGAGCCCTCTCAGGCGAAG
GAAAATGGAAAGAGAAGTGTAGATAACAGCTCCTTCACTCATGGGAAAACCGATCTAAACCAACTTCCAGCGATTCCCCC
TGTTTCAACTGGTCAAGGTCTGCCATATGCCCCTGTTGATTGGCCAAGCCCTGGAGATGTTTGGACTTGGAGAGTTGGGA
GGAGAGTGACTGCTACTGGGTATCATCAGGATAGATTTCTGATTCTCCCTCAAAGGCTTCAGCAAAAGAATGTCCCAAAG
TCTTTCGCAAGCAAAGTCCATCTTGGTCGTTATATTCAGTCGAATTTCCCAGGCATGGATGCTGATGCATTCTTATCTTC
TTTTAGCTGGAAGATTCCAGCTCTCTTCCAGCCTGCAAATAAAGTTGATGCTGCATCTCTTTTTGAGGAGACACCAAAGG
AAGTACAGAGCGAGGTTGGCCAGAATGATGATGCTCAGGTTGGGAAAAAAGAAGGAAACTCCCGATACAGCCAAAGGAAG
AGAAAACCAATGCCAACACAAACGTATGAACCTGTTGAAGCGAAACCTAAACCAACTCCCCGAGCTAGTAGCAAGAAGAA
GAAAGGAGCCACAACTCCTGGCACTGGACCGCAGTCCACGCCCAAACCGAAATCATCTCGACAATCCGCAAGACGTGCCT
CAAACCAGCAGCGTGGTGGTGCTGTGAACTTGAACTTCCAGAACGAAGAGGGTGAACCTGCTACTGCACCAAATACTAGT
AACAAGAGAAAGAAACGCGGAGCTAACTACGAGGAAGAAGATGTTTCTATTCCTCATATATATGTCTCTCCTATGAATGG
TGTCCTTGCGGTCTCACACTCGCCTATCGATGTTAACCCAGAAGAGTTTGACAGCTACCTGAACTCTCTTGATAACCTTA
TGCAGCAACCTCCAGAAGAGGTTGGGGGAGACTCGTCTGTTCTTGTTAGTGTAAGCTCTCCAATGAGAGAATATGAATGG
GCTGAAGCTCGAATGAAGATTTCATCTCTTCTGGAGAAGGATTTCACTACTTTGTTCCTCTCCAAGGACGCAACAGAGAT
AGCAGCATTGGCAACTAAACTGAGGAAAGATCCAAACCTTTCTGCTGAAGAGATTGTGAGATTGAAGCTGATGGAAGAGA
TTCCAACGTTTAGCGAAGTTTTCCAGGAGAACAAAGGGGTGATTGAAGAAGCTGATAGGTTCTTCTCTGCACTGGAGCTT
AACAAAGCTAAGGTAGCATCACTTAAATACGAATACAGCGACCTGAGGGAAAAACTAGGGAGCATCCAGATGGAAGTCGA
CTCAAACTCTGAGACAATCCGCCAAATCGATGACCAAATTGCTCAGCTTCAAGCTAGACGGTCAGAGTTGAAGCGGTACA
TCGGGACCAAGGAGAAAGAAAGGGTTGATCTAAGCTACGGTCAGAAAATGGTAGCGAACTCAATCCCAAAAGTTGTACAG
GAAGTTCAATCAGCTAACTCTAAGAAACATGAATGGGAATGTAAGAAGGATAATGCTCTTAAGCGTGAAGCAGAGATCCT
CTCTAAATTCACTTCTCTCAAAGGCTTCTTCTTCTAA