Details for Capsella Locus Carubv10013274m

Position : scaf_3 ( 5`- 4000443 .. 4003195 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013274m

Protein [Map View]
MSATMVKDEILNYSDDEEENFSDDGDWGDWKADDNGVGMGGGEEEEDDDSESDFLCLFCDSHHVSCDSLFEHCRLSHGFD
FRGVRKELKLDFYSSFKLINYIRSQVAENKCWSWRIEAADFKDVKFPWDEEKYLKPFSQEDSLLYSFADDEEDEEDTFDR
DAVMEDLQKLGDLSIDLEALGETSMSNSGKCNINGSKDVTLLSNCNALKQSSADGLIVNGKDAEPKVGNGRLSNRNIRKV
NENYFGSYSSFGIHKEMLSDKVRTDAYRDALLKNPTLLSGSVVMDVGCGTGILSLFAAKAGASRVVAVEASEKMAKVATK
IAKDNKVFSDNEHNGVLEVAHSMVEELEKSIQIQPHSVDVLVSEWMGYCLLYESMLSSVLYARDRWLKPGGAILPDTATM
FVAGFGKGATCLPFWEDVYGFDMSSIGKEILEDTARLPIVDVIQERDLVTQPALLQTFDLATMKPDEVDFTATATLEPTE
SEAKTRLCHGVVLWFDTGFTSRFCKENPTVLSTSPYTPPTHWAQTVLTFQEPISMAPASFLSGDDRRGDIGTEECPASSI
HLRVSVARSYEHRSIDISLEVTGLSSKGQKHRWPIQIFNL*

DNA
ATGTCGGCGACAATGGTGAAGGACGAGATTCTCAACTACAGTGATGATGAAGAAGAGAACTTCTCGGACGACGGAGACTG
GGGAGATTGGAAAGCAGACGATAATGGCGTAGGAATGGGAGGAGGAGAGGAGGAGGAGGATGACGACTCCGAATCTGATT
TTCTTTGTTTGTTTTGTGATTCTCACCACGTCTCCTGCGATTCACTCTTCGAACACTGTCGTCTGAGCCACGGGTTTGAT
TTTCGTGGTGTTAGAAAGGAATTGAAGCTCGATTTCTACTCTTCGTTTAAGCTCATCAACTATATTCGCTCACAGGTGGC
TGAGAACAAATGTTGGAGTTGGAGGATCGAAGCTGCTGATTTCAAAGATGTTAAGTTTCCTTGGGATGAAGAAAAGTATT
TGAAGCCCTTTTCGCAGGAGGATTCACTTTTGTATTCATTTGCAGATGATGAGGAAGATGAAGAAGACACGTTTGACAGA
GACGCAGTGATGGAGGATTTGCAGAAACTTGGGGATTTAAGCATTGATCTTGAGGCTTTAGGGGAAACTTCAATGTCGAA
CAGTGGTAAATGCAATATTAATGGAAGTAAGGATGTAACTTTGCTCTCAAACTGCAATGCCCTGAAGCAAAGTTCTGCGG
ATGGTTTGATAGTCAATGGTAAAGATGCAGAACCAAAGGTTGGTAATGGAAGGCTATCTAATAGGAACATCAGAAAGGTG
AATGAAAACTATTTTGGATCTTATAGTTCGTTCGGCATTCACAAGGAGATGCTTAGTGATAAGGTTAGAACAGACGCATA
CCGAGATGCACTTTTGAAGAATCCTACTCTCTTGAGTGGCTCTGTTGTAATGGATGTTGGTTGTGGAACTGGGATATTGA
GTCTCTTTGCTGCTAAAGCTGGGGCTTCAAGGGTAGTTGCTGTTGAAGCTAGTGAGAAGATGGCCAAAGTTGCAACTAAG
ATTGCGAAGGATAACAAAGTATTCAGTGATAACGAGCATAATGGGGTACTTGAAGTTGCACACTCAATGGTTGAAGAGCT
AGAGAAATCGATACAGATTCAACCTCATAGTGTTGATGTGTTAGTCAGCGAATGGATGGGATACTGCCTTTTATATGAGT
CAATGCTCAGTTCTGTGCTCTATGCAAGAGATCGGTGGTTAAAACCTGGAGGTGCAATCCTCCCTGACACGGCCACTATG
TTTGTTGCCGGATTTGGAAAAGGTGCCACATGTCTCCCTTTCTGGGAAGATGTCTATGGCTTTGACATGTCTTCAATTGG
TAAGGAAATACTTGAAGATACTGCTCGACTTCCCATTGTTGACGTTATACAGGAGCGTGATTTAGTGACGCAGCCTGCCC
TTCTTCAGACATTTGACCTGGCTACCATGAAACCGGATGAAGTAGATTTCACAGCAACAGCAACGCTGGAGCCCACTGAG
TCAGAAGCAAAAACTAGGTTGTGCCATGGTGTTGTGTTGTGGTTTGACACAGGTTTCACCAGTAGGTTCTGCAAGGAAAA
TCCAACTGTACTATCCACATCACCCTACACTCCCCCAACACACTGGGCTCAGACAGTCTTAACTTTCCAAGAACCAATCT
CAATGGCTCCGGCCTCATTTCTGTCTGGTGATGACAGAAGAGGAGACATTGGAACTGAAGAGTGTCCTGCCTCAAGCATT
CATCTGCGTGTGAGTGTTGCACGATCATATGAGCATCGCAGCATTGACATCTCCTTAGAGGTTACTGGGCTGAGCTCAAA
GGGTCAGAAGCATCGTTGGCCAATTCAGATATTCAATCTATGA