Details for Capsella Locus Carubv10013260m

Position : scaf_3 ( 5`- 5124959 .. 5127052 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013260m

Protein [Map View]
MLCQDLSFSKTLNPSFSFRKSPPKSGVRRVVSVLPVITERNYAFRLKSSELFLRNDAGFRRDVRALAGRSKKKLGGGSSG
GRIEGDADMRKQVKRNARDKSKKLAESLFYRLYNNPDKSRSNILSSHPDKFTEEELEMIGLGYDRMVRFMDKDDPRLRHP
YDWFKYGEFGPYSWRGVVVGDPVRGTISDECVTMIGEVENHEEFEKIEQHEMNLAFQKRVKELDSNVGLRYFWVFVRHPK
WRLSELPWEQWTLVSEVAVEADKKQRLDKWNLMGRLGNKSRSLICQCAAWFRPDIVYVKKPVFQCRFEPQEDFFNSLIPY
LNPVTESGFVCEVEDDEGRVELSTYYGGLCKMLKVRQTAFVDDVVNAYEKSSDEKKSKVLKFLLGNHPNELLHPYTKEWK
AKLEEMELGCDAPDENEDEVNIRGNSEKAEFSEWIEDEAENDNDDDGGQVDEEDDDDNMVVDVEGSEEEDSLEGVIEELD
PEDDERYWEEQFNKATSNAERMEKLAEMSMVVSDKFYEKQLKAMEEREKSEIEGDELEMRGKKAKVKPEEWKTVGYGRWM
KKIKKSRIPPELFLRAAVRPFVYRNLVKEIVLTRHAILEGEIGQKE*

DNA
ATGCTGTGTCAAGATTTATCCTTTTCTAAAACCCTGAACCCTAGCTTCTCCTTCCGTAAATCTCCACCCAAATCCGGCGT
ACGAAGGGTCGTTTCGGTTTTACCGGTTATTACTGAGAGAAATTATGCGTTCAGGCTCAAAAGCTCCGAGCTTTTTCTCA
GAAATGATGCTGGATTCCGGCGAGACGTGCGGGCTTTGGCGGGGAGGAGCAAGAAGAAGCTTGGAGGAGGTTCATCTGGT
GGGAGGATAGAAGGAGATGCAGATATGAGGAAGCAGGTGAAGCGAAATGCTCGTGATAAGTCGAAGAAGCTAGCGGAGTC
TTTGTTTTACAGATTGTATAATAATCCTGACAAGAGTCGAAGCAACATTCTCAGTAGCCACCCAGATAAGTTCACGGAAG
AGGAGCTTGAGATGATTGGGCTTGGATACGATAGGATGGTTCGGTTTATGGATAAGGACGACCCGAGATTGCGTCATCCT
TATGATTGGTTCAAGTATGGAGAGTTCGGACCTTACTCGTGGCGTGGTGTTGTGGTTGGTGATCCGGTTCGTGGTACTAT
CTCTGATGAGTGTGTTACTATGATTGGTGAAGTGGAGAATCATGAAGAGTTTGAGAAGATTGAGCAGCATGAGATGAATT
TAGCTTTCCAGAAGAGGGTTAAGGAGTTGGATTCAAATGTTGGTTTGAGGTATTTTTGGGTTTTCGTTAGGCATCCGAAA
TGGAGACTCAGTGAGTTGCCGTGGGAGCAATGGACGTTGGTTAGTGAAGTGGCTGTGGAAGCGGATAAGAAGCAGAGGCT
AGACAAATGGAATTTGATGGGGAGATTGGGGAACAAATCTCGGTCTTTGATATGTCAGTGTGCCGCTTGGTTTAGACCTG
ATATTGTGTATGTGAAGAAGCCTGTGTTTCAGTGCAGGTTTGAGCCTCAAGAAGATTTCTTTAACTCGCTCATCCCTTAT
CTGAACCCGGTAACAGAATCCGGATTCGTGTGTGAAGTGGAGGATGATGAAGGTAGAGTGGAGTTGAGTACTTATTACGG
AGGGCTGTGTAAGATGCTGAAGGTGAGACAGACAGCTTTTGTGGATGATGTGGTAAATGCGTATGAGAAGTCGAGTGATG
AGAAGAAATCCAAAGTGTTGAAGTTCTTGCTCGGGAACCACCCAAATGAGTTGTTGCATCCATATACAAAAGAGTGGAAA
GCAAAGTTGGAGGAGATGGAGCTAGGGTGTGATGCTCCAGATGAAAATGAGGATGAGGTGAACATTAGGGGAAACTCAGA
GAAGGCTGAATTCTCAGAATGGATTGAAGATGAAGCTGAGAATGACAATGATGATGATGGTGGTCAGGTGGATGAAGAAG
ATGACGACGATAACATGGTTGTTGATGTGGAGGGAAGCGAGGAAGAAGACAGTTTAGAAGGTGTAATAGAAGAGTTGGAT
CCGGAAGATGATGAAAGGTACTGGGAAGAGCAATTCAATAAAGCAACGAGCAACGCAGAGAGGATGGAGAAGCTTGCGGA
GATGAGTATGGTGGTATCAGATAAGTTTTATGAGAAGCAGTTAAAGGCAATGGAGGAGAGGGAAAAGAGTGAGATTGAAG
GAGATGAGTTGGAAATGAGAGGTAAGAAGGCAAAAGTGAAACCAGAAGAATGGAAGACAGTAGGATATGGAAGGTGGATG
AAGAAGATAAAGAAGAGTAGGATCCCACCTGAGCTGTTTCTCCGTGCTGCTGTTCGGCCCTTTGTTTACAGAAACCTTGT
CAAAGAGATTGTTCTGACAAGACACGCCATTTTGGAAGGCGAGATTGGTCAAAAGGAGTGA