Details for Capsella Locus Carubv10013243m

Position : scaf_3 ( 5`- 7631233 .. 7633081 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013243m

Protein [Map View]
ILSNIKFISFFDMDNASKQLYASPPPFCPFARFTNNEEEYQLIHFGESPILSNVADDKSSQSSSPHFRPLDWCNTIDGTY
EAILCGVCMSPIIDTPFYSCKECLYIFSQRNVNGFHKECIEPVSKHPYHPKHSLRFIHYFELRPDNKLCFCLNNSASVYN
CSLCDFTICQPCSRNPPLLAIDNPKKHMHTLFYFPRKGSMICDVCSFSDQSSLVYSCTQCDFLTHMNCVYFPCVIKISRH
QHRLSFISSPTPGKWWCGVCRGKIDINYGRYSCVKGCNYGVHSKCATRKDVWDGKELEGTPEDEYEEDITKSFYEISDGI
IQHFSHPDHHMRLNAETDRAFDENKYCQACTLPVCDGIIYNCMQCEFVLHQECAHLPRKKQHATHPHPLSLQVEHQDGWF
TCEACDRRSNGFGYLCCERDCDYMLDMCCASIDEPFDHPHHPHPLYLTFDPETLQYCWICQKMGVMRLNCGESYSCGFVL
CFGCATLPTKLRYKHDQHFLIFGYDKDASGKYVCDVCEQEADPKSGIYTCSDCNATLHIQCLLGLREDMYMMPRREEFIF
REFNVTVLPNNHLSRNICKCCHNRCSNKVVYKISDTVKVCSLFCIYEWWHIKNYS*

DNA
ATTTTATCTAACATAAAATTCATTTCCTTCTTCGACATGGATAATGCCTCAAAACAACTATATGCTTCTCCTCCCCCCTT
TTGCCCTTTTGCACGCTTTACAAACAACGAAGAGGAGTATCAACTGATACATTTCGGAGAGTCACCGATTCTTTCTAATG
TCGCAGACGACAAGTCTTCACAATCATCCTCACCTCACTTCCGTCCATTAGATTGGTGCAACACCATAGATGGTACATAC
GAAGCCATCTTATGCGGGGTTTGCATGAGTCCTATCATTGATACCCCATTTTATTCTTGCAAAGAATGTCTTTACATTTT
TTCACAACGAAATGTTAATGGCTTTCACAAAGAGTGTATCGAGCCGGTATCGAAGCACCCTTATCATCCTAAACATTCTC
TTCGGTTTATTCATTATTTTGAATTGCGTCCTGATAATAAGCTATGCTTTTGTTTAAATAATAGTGCTTCGGTATACAAC
TGCTCTCTATGCGATTTTACTATATGTCAACCTTGTTCGAGAAATCCACCACTCCTTGCAATAGACAATCCAAAGAAGCA
TATGCATACCCTCTTCTACTTTCCTAGAAAAGGCTCAATGATTTGTGACGTTTGTTCTTTTAGTGATCAAAGTTCTTTGG
TGTATTCTTGCACTCAGTGTGATTTTCTAACCCACATGAATTGTGTGTATTTCCCATGCGTCATTAAAATTTCGCGTCAT
CAACACCGCCTCTCGTTCATTTCCTCACCTACTCCAGGCAAATGGTGGTGTGGAGTGTGTCGTGGAAAGATAGACATAAA
CTATGGAAGGTATTCTTGCGTTAAGGGTTGCAACTATGGGGTTCATTCTAAATGTGCGACACGAAAAGATGTATGGGATG
GGAAAGAACTTGAGGGAACACCAGAAGATGAATATGAAGAAGATATTACTAAGTCGTTTTACGAAATAAGTGACGGCATT
ATACAACATTTCAGTCATCCAGATCATCATATGAGACTTAATGCAGAGACTGATAGAGCATTTGACGAGAACAAATATTG
TCAAGCATGCACACTTCCTGTATGTGATGGTATTATTTACAATTGCATGCAATGTGAGTTTGTTCTCCATCAAGAATGTG
CACATCTTCCTCGGAAGAAACAACACGCGACACATCCTCATCCCCTTAGTTTACAAGTGGAACATCAAGATGGTTGGTTC
ACATGTGAAGCTTGTGATCGTAGAAGCAACGGTTTCGGGTACTTGTGTTGTGAAAGAGACTGTGACTATATGTTAGACAT
GTGTTGCGCTTCCATAGACGAGCCATTTGATCATCCGCATCATCCACACCCCTTGTATCTTACATTTGACCCTGAAACTT
TGCAATACTGTTGGATTTGCCAAAAAATGGGAGTTATGCGTCTAAATTGTGGAGAATCATATTCATGTGGTTTTGTTTTG
TGTTTTGGTTGTGCCACATTGCCGACTAAATTGAGGTACAAGCATGATCAGCATTTCCTCATATTTGGTTATGATAAAGA
CGCGAGTGGTAAGTATGTGTGTGATGTTTGTGAACAAGAAGCAGATCCAAAGAGTGGAATTTATACGTGCAGCGATTGCA
ACGCCACATTGCATATTCAATGTCTACTTGGACTTAGAGAGGACATGTATATGATGCCTAGAAGAGAAGAATTCATATTC
CGTGAATTTAATGTGACCGTTCTTCCCAATAATCATCTTAGTCGCAACATATGCAAGTGTTGCCATAATCGTTGTTCGAA
TAAAGTGGTCTACAAAATCTCTGATACTGTAAAAGTATGCTCTCTATTCTGTATATATGAATGGTGGCACATAAAGAACT
ATTCTTAA