Details for Capsella Locus Carubv10013242m

Position : scaf_3 ( 5`- 2309102 .. 2313620 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013242m

Protein [Map View]
ASAVASSNSGEPMEGTSGSLNPTTDTSGIMPEFDPKTMRSSKPGLKRLFITTSVLFSFLLGVPFLWKSVEIYRSPLPFHD
IDSLSDQIESTPLRFPCNFHAVFVGFRSTDADNLRSQIQDGINQLTHLSPQCGSCSFSLSVTIQNPAEQCSETLGHNPSS
CSYRCGMIKSNDFGVGLDDTVDESLNDVFSGCSANSRKMYSVVVVNKENANGEDEVKAVVGKRRHAWIVGSGLEERNDDM
VSRVSEIFVKMFMNGGRDEDSIHGEFMPVGSDGRIVLSFSLLNSNPRDWVYDWDFQRIDDALLAPVTKALAPIANISVES
QVLYHTPKSSFSSWDEQLQSYIFRTSDLPFFVNSNEWHLDTSAGASGRSKILQFVVYIPSGSECPLLLQLPNGEISKTNG
FISPMWGGVIVWNPGNCDKDSESPIRNTISPQDIEQIVEIFLGQFRQLFGFKSEAIYTSVLGTYKILPSERGFTEWELDV
LSRKHTCFNLHSCSTTLSSLSKLVRSLPRMIIKDEIGEQVKYSLKAAKLAQSNASLGGYSSSASSSREARSLAENAFFHP
SIMSVSYFSYEHCFAVYSPFFLPVVAHVVLAALREWKRYRQEKAKYLTWLTRKKTA*

DNA
GCAAGTGCTGTGGCATCTTCCAACTCTGGGGAGCCGATGGAAGGAACCTCTGGTAGTCTGAATCCGACGACAGACACTTC
GGGAATCATGCCGGAGTTTGATCCGAAGACTATGCGTTCCTCAAAACCTGGCTTGAAGCGTCTCTTCATCACCACCTCTG
TGCTTTTTTCATTCCTTTTAGGTGTGCCATTTCTTTGGAAGTCAGTGGAAATATATCGTTCTCCGTTACCGTTTCACGAT
ATAGACTCGCTCTCCGATCAAATTGAGTCGACGCCATTGCGATTCCCCTGCAATTTCCACGCCGTATTCGTCGGTTTCCG
ATCGACGGATGCGGATAACTTACGATCTCAGATACAAGATGGTATTAATCAGTTGACCCATCTTAGTCCACAATGTGGTT
CTTGCAGTTTTTCCCTCTCTGTCACCATTCAAAACCCAGCTGAGCAGTGTTCAGAAACACTTGGGCACAATCCTTCCTCC
TGCTCTTATAGATGCGGAATGATCAAAAGTAATGATTTTGGTGTTGGATTGGACGATACTGTGGATGAATCACTGAATGA
TGTGTTCAGTGGTTGCTCTGCGAACAGTAGGAAAATGTACAGTGTGGTCGTGGTGAACAAAGAAAATGCCAATGGTGAAG
ATGAGGTCAAAGCTGTGGTGGGCAAGCGAAGGCATGCGTGGATTGTGGGAAGTGGATTAGAAGAGAGAAATGATGACATG
GTGTCCAGAGTTTCTGAGATTTTCGTTAAAATGTTTATGAATGGTGGAAGAGACGAAGACTCAATTCATGGGGAATTTAT
GCCTGTAGGATCAGATGGGAGGATTGTTCTTTCCTTCAGTCTGTTAAATTCTAATCCACGTGATTGGGTCTACGATTGGG
ACTTTCAGAGGATAGACGATGCTTTGTTGGCTCCGGTGACTAAGGCCTTGGCACCTATAGCTAATATAAGTGTCGAAAGT
CAGGTTTTGTATCATACACCGAAGTCTTCATTTTCATCTTGGGATGAACAACTTCAGAGCTACATCTTTAGGACCAGTGA
TCTTCCTTTTTTTGTGAATTCGAACGAATGGCACTTGGATACTTCTGCTGGAGCCAGTGGACGGTCCAAAATACTGCAAT
TTGTGGTATATATTCCATCCGGATCAGAGTGTCCTCTTCTTTTGCAGTTGCCAAATGGGGAGATATCTAAAACAAATGGC
TTCATATCTCCTATGTGGGGCGGTGTGATTGTGTGGAACCCGGGAAATTGTGATAAGGACTCTGAAAGCCCAATTAGGAA
CACGATATCGCCTCAGGATATTGAGCAAATAGTTGAAATTTTCTTGGGACAATTTCGACAACTATTTGGCTTTAAGTCCG
AAGCCATTTATACCAGTGTATTGGGCACTTACAAGATTTTACCTAGTGAAAGAGGCTTTACAGAGTGGGAATTGGATGTC
TTGTCACGGAAGCACACATGCTTCAATCTCCATTCTTGTTCCACAACCCTCAGTTCTCTCTCTAAATTGGTTCGGTCACT
CCCCAGGATGATTATCAAGGATGAAATTGGAGAACAAGTAAAATATTCTCTAAAAGCAGCAAAGTTGGCTCAGTCTAATG
CTTCTTTGGGAGGATACAGTTCTTCAGCCAGTTCTTCAAGAGAAGCTAGGTCCCTAGCCGAGAATGCGTTCTTCCATCCA
TCCATCATGTCCGTCAGCTACTTCTCTTATGAACATTGCTTTGCAGTGTACTCGCCATTTTTCCTGCCTGTGGTAGCACA
CGTTGTCCTTGCAGCACTACGAGAATGGAAGAGATATAGACAAGAGAAGGCAAAGTACTTGACATGGCTAACCAGAAAGA
AGACGGCCTAG