Details for Capsella Locus Carubv10013238m

Position : scaf_3 ( 5`- 4476846 .. 4480535 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013238m

Protein [Map View]
FHLSRAALVEKQREKEIDMEALKVWSLTATPLKQLLRLSSSSTRLASTIYGRRSYHLSPVLRCAAAASSSNATAAETSKP
SSRNRRSASSSNSTSDREAIRSIRLKKVEELRGQGLEPYAYKWEKTHSANQLQEIYKHLANGDESDNESDRVSVAGRVVA
RRAFGKLAFLTLRDDSGTIQLYCEKERLSDDQFEQLKAFVDIGDILGASGSMKRTEKGELSICLNSFSVLTKSLLPLPDK
YHGLTDIDKRYRQRYVDMIANPEVADVFRRRAKIVSEIRKTVESFGYLEVETPVLQGAAGGAEARPFVTFHNSLGRDLYL
RIATELHLKRMLVGGFEKVYEIGRIFRNEGISTRHNPEFTTIEMYEAYSDYQSMMDMAELIVTQCAMAVHGKLTIDYQGT
EICLERPWRRETMHNLVKEITGIDFSELGVDIGNAKDTVLLALKDVLEPKDKSGIRACSSLGHLLNEVFEVVVEPKLVQP
TFVLDYPIEISPLAKPHRSNAVLTERFELFICGREMANAFSELTDPVDQRTRLEEQVRQHNAKRAEAAPESPEPNTKKDD
DDDDESYEVTLDEDFLTALEYGMPPASGMGLGIDRLVMLLTNSASIRDVIAFPVLKVQQ*

DNA
TTCCACCTATCCAGAGCAGCACTAGTCGAGAAACAAAGAGAGAAAGAGATAGATATGGAGGCACTTAAGGTATGGAGTCT
AACGGCGACGCCATTGAAGCAGTTACTCCGTCTATCTTCTTCCTCTACGCGTCTTGCTAGTACAATTTATGGAAGAAGAT
CCTATCATTTATCACCGGTGCTCCGATGTGCCGCAGCAGCTTCTTCTTCAAATGCCACGGCAGCTGAAACTTCTAAACCA
TCCAGTCGCAACCGCCGGTCCGCTTCCTCTTCCAATTCCACCTCTGATCGTGAAGCTATCCGCTCCATTCGCCTTAAAAA
GGTTGAAGAACTGAGAGGTCAAGGTCTTGAACCGTATGCTTATAAGTGGGAAAAAACTCACAGTGCAAATCAGCTTCAAG
AGATATATAAGCATTTAGCTAATGGTGACGAATCAGACAATGAGAGTGATCGCGTTTCTGTTGCCGGCAGAGTCGTTGCT
CGTAGAGCGTTTGGGAAACTTGCATTCTTGACTCTGAGGGATGACTCTGGAACCATTCAGCTCTACTGTGAGAAGGAAAG
GCTTTCAGATGATCAGTTTGAACAGTTGAAGGCATTTGTCGATATTGGTGATATTTTGGGTGCTAGTGGATCAATGAAGA
GGACTGAGAAAGGGGAGCTTTCTATATGTTTGAATTCTTTTTCAGTTCTCACCAAATCTCTCCTTCCGCTGCCAGACAAA
TACCATGGTCTAACTGATATTGATAAACGTTACCGCCAACGGTATGTTGATATGATTGCTAATCCTGAAGTAGCTGATGT
ATTCCGGAGAAGGGCAAAAATCGTTTCAGAGATACGCAAGACAGTTGAGTCCTTTGGATATTTGGAGGTTGAAACTCCAG
TTCTTCAGGGAGCAGCTGGTGGAGCTGAAGCAAGACCTTTTGTAACGTTTCATAACTCACTTGGGAGGGATCTCTACCTG
AGGATTGCAACTGAGCTTCACTTGAAGAGAATGCTGGTTGGTGGGTTTGAGAAAGTGTATGAAATTGGTCGTATATTTAG
AAACGAAGGCATTTCGACACGGCACAATCCTGAATTTACAACAATCGAGATGTATGAAGCTTATTCGGACTACCAGAGCA
TGATGGACATGGCAGAATTAATCGTCACTCAATGTGCAATGGCAGTTCATGGGAAGCTAACAATTGATTACCAGGGAACA
GAAATCTGCCTCGAGCGGCCTTGGAGGAGAGAAACCATGCATAATCTCGTTAAAGAGATAACAGGAATCGATTTCAGTGA
GCTAGGGGTAGATATTGGAAATGCCAAAGACACAGTTCTGCTGGCACTCAAAGATGTGCTTGAGCCCAAGGACAAATCTG
GAATCAGAGCTTGCTCTTCCCTAGGCCATCTTCTTAATGAGGTTTTTGAAGTTGTAGTAGAGCCAAAGCTTGTGCAACCC
ACATTTGTCTTGGACTACCCAATCGAAATTTCTCCTTTGGCCAAGCCACATCGCAGCAATGCAGTTTTGACAGAAAGATT
TGAGCTGTTCATATGTGGCCGTGAAATGGCAAATGCATTCTCTGAATTGACTGATCCAGTGGACCAGAGGACGCGGTTGG
AAGAGCAAGTAAGGCAGCATAACGCAAAGAGAGCAGAGGCTGCACCGGAATCTCCTGAACCAAACACAAAGAAAGATGAT
GATGATGATGATGAGTCATATGAGGTGACCCTTGACGAAGACTTTCTCACTGCCCTGGAATACGGAATGCCTCCGGCTTC
GGGAATGGGGCTTGGAATAGACAGACTGGTGATGCTGCTGACCAACTCCGCTAGTATAAGAGACGTGATTGCTTTTCCTG
TTCTGAAAGTTCAGCAGTAA