Details for Capsella Locus Carubv10013237m

Position : scaf_3 ( 5`- 5298624 .. 5301996 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013237m

Protein [Map View]
MKPDVVEIAPPSCSRTLTPTKAETPEVIDAKLYDTLSGGVLNGSNVDPKNKGKAIEEFDSLSYDDQDDDYVAGSPGDAYG
YPGSSPVSNSLLDPDSLIYDDDYDYADQSTYEMEETDNYSMYQDLFDAKDVPTGVEVSMDWFPNSADKESAKSSKSSHDK
NGNVSDVTASSSKKATTGGGIHSQSSFSAMVTHVAQPWNALPHNSKGVIPNSAYALPQNSKGFQYPAPPFTLGSASATSK
TYFSSPFQPQTPDLVTGEAPAPGPASSGLLLPVPPSTSGLKGYGARQRLGEVVAPPDPSRVKRKMEDYLSTYVFFKRFDI
VEDYSDHHYASKGSTSKQYTKEWAKRIQEEWKILENDLPDLIFVRAYESRMDLLRAVIIGAQGTPYHDGLFFFDIFFPDT
YPSVPPIVHYHSGGLRINPNLYNCGKVCLSLLGTWAGNQREEKWIPNKSTMLQVLVSIQGLILNQKPYFNEPGYERSAGS
VMGEKNSKDYSENTLILSLKTMVYTMRRPPKYFEDFAYGHFYSCAHDVLKACNAYRNGAPPGTLVKGAQDVEESSQSSSE
KFRTDVATFVETVLLKEFILLGVLGLEEEGEENGTETKNVAESSNSTRSSSKRDRVSSS*

DNA
ATGAAGCCAGACGTAGTGGAGATCGCTCCTCCTTCTTGCTCGAGAACACTCACACCAACCAAGGCTGAAACTCCAGAAGT
GATTGATGCGAAGCTATACGATACGCTAAGCGGTGGTGTTCTTAATGGCAGCAATGTTGATCCCAAGAATAAAGGGAAGG
CTATAGAGGAGTTTGATTCCCTTTCTTACGATGACCAAGATGATGATTATGTTGCGGGGTCTCCTGGCGATGCTTATGGT
TACCCTGGATCGTCTCCAGTATCAAATAGTTTGCTTGACCCGGATTCTTTGATTTATGATGACGACTACGACTATGCTGA
CCAATCTACTTATGAAATGGAGGAGACGGATAACTACTCCATGTATCAAGACCTTTTTGATGCTAAGGATGTGCCGACTG
GTGTCGAGGTGTCAATGGATTGGTTTCCAAATTCAGCTGACAAGGAATCAGCGAAAAGCAGCAAATCTTCTCATGATAAA
AATGGGAATGTATCAGATGTTACTGCTAGCAGCTCCAAAAAGGCAACAACAGGAGGTGGAATCCACTCTCAGTCTTCTTT
CTCTGCTATGGTAACCCATGTTGCTCAACCATGGAATGCTTTGCCGCACAACTCTAAGGGAGTCATACCTAACTCTGCTT
ATGCCTTGCCACAAAACAGCAAGGGTTTCCAATATCCTGCACCACCTTTCACTCTCGGTTCTGCTTCTGCAACCTCCAAA
ACGTATTTTTCCAGTCCTTTTCAGCCTCAGACTCCCGATTTAGTAACTGGGGAGGCTCCGGCCCCTGGTCCAGCTTCTTC
TGGTTTATTGCTTCCGGTACCTCCATCTACATCCGGTTTAAAAGGTTATGGTGCTCGGCAGAGATTGGGGGAGGTTGTTG
CACCTCCAGATCCTTCCAGAGTTAAGAGAAAAATGGAGGATTATCTTTCGACGTATGTGTTTTTCAAAAGATTTGACATT
GTCGAAGATTATTCAGACCACCACTATGCTTCTAAGGGATCAACTTCTAAGCAGTATACAAAGGAGTGGGCGAAGAGGAT
CCAAGAGGAGTGGAAAATTCTTGAGAATGATTTGCCAGATTTGATATTTGTCAGAGCTTATGAATCTAGGATGGATCTTT
TAAGGGCTGTGATTATCGGAGCCCAAGGAACTCCCTACCATGATGGCCTGTTCTTTTTTGACATCTTCTTCCCGGATACA
TACCCTTCTGTACCACCGATTGTTCATTACCATTCTGGTGGGCTAAGAATCAACCCGAATCTGTACAATTGTGGGAAAGT
GTGTCTGAGTCTTCTCGGCACTTGGGCTGGTAACCAGAGGGAGGAGAAATGGATCCCCAACAAATCCACAATGTTACAGG
TTCTTGTCTCGATCCAAGGTCTAATTTTAAATCAGAAACCTTACTTCAACGAGCCTGGTTACGAGAGGTCAGCGGGTTCT
GTAATGGGAGAGAAAAACTCTAAAGATTACAGTGAAAACACATTGATACTGTCTTTAAAGACTATGGTTTATACCATGAG
GAGGCCACCCAAGTATTTTGAAGACTTTGCGTATGGACATTTCTACAGCTGTGCTCACGACGTGTTGAAGGCGTGTAATG
CTTATAGAAATGGAGCTCCACCGGGAACTCTGGTGAAGGGGGCTCAAGATGTGGAAGAGAGTAGCCAGAGCAGCTCTGAG
AAGTTTAGGACAGATGTGGCTACCTTTGTGGAGACAGTGCTGTTGAAGGAGTTTATTCTTTTAGGTGTGCTCGGTCTCGA
AGAGGAGGGAGAAGAGAATGGCACTGAGACTAAAAACGTTGCAGAGAGCAGCAACAGTACCAGATCAAGCTCCAAGAGAG
ACCGAGTTTCTTCTAGTTGA