Details for Capsella Locus Carubv10013232m

Position : scaf_3 ( 5`- 1533371 .. 1536435 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013232m

Protein [Map View]
MDRRSWLWRRKSSEKSPGETESTGSVSSHSERFSDDQRSQSPELISKPATREEEATADIKILTERLSAALLNVSLKEDLA
KQHAKVAEEAVSGWEKAENEAAALKQQLDASTSKVSALEDRNSHLDSALKECVRQLWQGREEQNQKIEEAVNEKCQEWET
RKSELEAQIEELHARLQTGKEEVTSTASVHEDLYPKLEALEKENSALKLQLRSKTEEVKIRTIERDLSTQAAESASKQQL
EGIKKLTKLEAECRKLRVMLRRSDNSSELKSSIDNQSDYSGRVSFSDNEMQSPSAKITGKASMAPSVDIGLMDDFLEMEK
LAALPHSEPGRKHSESNKELEKSNAQSSQLKHELKASLHRISEMEEKVEMLEVEKLQLEMALNGSKEQSEALQSRLKETE
GKLSELKKLEAENQELELLLGESGKQIQDLQRQLNKAQVNLSELETTRAEKLELTICLNGTKKQLETSQNRLKETERKLT
ELQTLLRLTKDAKEAAEDGIKAANAKAEAVESRLRDVEAEAESLILKIKSLEDVTEEERALSSKHISKCKELQDEISKLK
RELELYQETEHEPNHMKSFELKQEKELAVAASKFAECQRTIASLGQRLQSLATLEDFLIET*

DNA
ATGGACCGGAGGAGCTGGCTTTGGCGGAGGAAGTCATCTGAGAAAAGTCCCGGCGAAACTGAGAGTACTGGCTCTGTCTC
TTCCCATTCTGAAAGATTCTCAGACGATCAGAGATCTCAATCACCGGAATTAATCTCTAAACCGGCTACTAGAGAAGAAG
AGGCAACGGCGGACATCAAGATTCTAACGGAGAGGCTCTCTGCAGCTCTTTTAAATGTCAGTTTAAAGGAAGATCTTGCA
AAACAGCATGCTAAAGTTGCAGAAGAAGCTGTCTCAGGTTGGGAGAAGGCAGAGAACGAAGCTGCGGCTCTGAAGCAACA
GCTTGATGCTTCTACAAGCAAGGTTTCGGCTCTCGAGGATCGAAATAGTCATCTTGATAGTGCGCTAAAGGAATGTGTGA
GACAGCTCTGGCAAGGAAGAGAGGAGCAAAATCAGAAGATCGAAGAAGCTGTAAACGAGAAATGCCAAGAGTGGGAAACT
AGAAAATCTGAACTTGAAGCCCAAATTGAGGAGCTCCACGCTAGACTTCAAACGGGAAAAGAAGAGGTCACTTCTACTGC
TTCGGTCCATGAAGACCTTTACCCGAAACTCGAGGCTTTAGAGAAAGAGAACTCGGCTTTGAAGCTTCAACTACGTTCAA
AAACTGAGGAGGTCAAGATTAGAACTATAGAGAGGGACTTGAGCACTCAGGCAGCTGAATCTGCCAGTAAACAACAGCTG
GAAGGGATCAAAAAGCTGACGAAACTCGAGGCAGAATGCAGGAAACTGAGAGTCATGCTTCGGAGATCAGACAATTCCAG
TGAGCTCAAATCTTCTATAGATAACCAATCAGACTACTCCGGGAGAGTTTCTTTTAGTGATAATGAAATGCAGAGTCCCT
CTGCAAAGATAACCGGAAAAGCTTCGATGGCTCCTTCGGTAGACATTGGTTTAATGGATGATTTTCTTGAGATGGAAAAG
CTTGCTGCTCTGCCGCATTCTGAACCGGGAAGAAAACATTCAGAGAGTAACAAGGAGTTAGAGAAATCTAATGCTCAATC
AAGCCAACTAAAACATGAACTCAAAGCATCGCTTCACAGAATTTCTGAAATGGAAGAAAAGGTAGAGATGTTAGAGGTAG
AGAAATTGCAACTGGAGATGGCTTTGAACGGATCCAAAGAGCAAAGCGAGGCATTGCAGAGTCGACTAAAGGAGACAGAA
GGGAAGTTATCCGAGTTGAAGAAACTAGAAGCAGAGAACCAAGAACTAGAGTTGTTGTTGGGTGAATCAGGAAAGCAAAT
TCAGGATCTTCAGAGACAGTTAAACAAAGCTCAAGTGAATCTGTCAGAATTAGAGACTACACGAGCAGAGAAGCTGGAAT
TGACCATTTGTTTGAATGGAACAAAGAAGCAGCTTGAGACATCGCAAAATCGGCTAAAGGAAACAGAGAGAAAGTTAACA
GAGCTTCAAACTCTACTGCGTCTAACGAAGGATGCAAAAGAAGCGGCTGAGGATGGTATCAAGGCTGCAAATGCGAAAGC
TGAAGCGGTTGAATCAAGACTTAGAGATGTCGAAGCAGAAGCTGAATCTTTGATCTTGAAAATCAAATCTCTGGAAGATG
TCACAGAAGAGGAACGTGCTTTATCATCAAAACACATTTCAAAGTGCAAAGAACTGCAAGATGAGATCTCAAAACTAAAA
CGCGAACTTGAGCTTTATCAAGAAACAGAGCATGAGCCTAACCATATGAAAAGTTTTGAGCTGAAGCAGGAGAAGGAATT
AGCAGTGGCAGCCTCAAAATTTGCAGAGTGCCAGAGGACAATTGCTTCGCTGGGGCAGCGATTACAGTCACTCGCCACAC
TTGAAGATTTCTTGATTGAAACTTGA