Details for Capsella Locus Carubv10013230m

Position : scaf_3 ( 5`- 1347207 .. 1351200 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013230m

Protein [Map View]
MDTPEKNRISAVSFRNFEDSPVFQYINDLSPIEPVKPPRSDNILHSLAFTSPSSLFSSPQLNSYRDSRFSIKRHRTLDLS
SPVVVIGETVKNSPDALEAVKITGLSEEQLKCRPARLANVSETKPFKEQLSLAIELADSLKNGREGCDSQMVSCDEEPMD
AENEIGRSGGLRELSDELCRQTNDSLDFDAGSDGVLQTEEMGTVSVFGAENAMLEVAGIQNSEQQIPKITDPKFYSFASE
PLQFSICCNNSVNVVEPRGSCSVQISPGAPEITLNRSSKVAAIASIAEAECKEDTGLQPSRKQQSVRRRCLTFDVGGSHK
KIPLRDSTNDLPLHSASISKAPSPQECLETSKQDTDEIIPIPRTIGLHLNSFVNPSVSSDRKKKKINDDRDLGYSDVKIM
EAPERSMEGESFDQHMATKNRKLSQGLDELGSCKRCKCRKSKCLKLYCDCFAAGLYCVEPCSCQNCFNKPIHEDLVIKAR
EVIEARNPLAFAPKVVSTSDSAIDLWDENSKTPASARHTRGCNCRKSGCLKKYCECYMMGVGCSSNCRCMGCKNNFIHKN
EKCEGESDAVTINDEAKDNDDHADASSQNEDASKSERRNCVLLQSPVAFRSLASLRKLSEL*

DNA
ATGGACACTCCTGAGAAGAACCGCATCTCCGCCGTTTCCTTCCGCAACTTTGAGGATTCTCCAGTTTTTCAATATATTAA
TGATCTTTCACCCATAGAGCCAGTAAAGCCACCACGCTCAGATAATATCTTGCACTCATTGGCTTTTACATCTCCGTCAT
CTCTATTTAGTTCGCCGCAGTTAAACTCTTACCGAGATTCCAGATTTTCCATCAAAAGGCATCGTACACTAGATTTATCT
AGCCCAGTAGTTGTCATTGGTGAGACTGTCAAAAACTCACCAGATGCTCTGGAAGCTGTAAAGATAACTGGTCTGAGTGA
GGAGCAGCTAAAGTGTAGACCTGCGCGGTTGGCTAATGTTTCTGAAACCAAGCCATTTAAGGAGCAGTTAAGCTTAGCAA
TTGAGTTGGCAGATTCACTTAAAAATGGAAGGGAGGGATGTGATAGTCAAATGGTTTCCTGTGATGAAGAACCAATGGAT
GCTGAAAATGAAATAGGAAGAAGTGGTGGATTGAGAGAGCTTTCTGATGAGTTATGTAGACAGACTAATGATTCACTTGA
CTTTGATGCTGGTTCAGATGGGGTACTTCAAACTGAAGAAATGGGAACTGTGAGTGTGTTTGGGGCAGAAAATGCCATGC
TTGAGGTTGCTGGTATCCAGAACAGTGAGCAACAGATTCCAAAGATCACAGATCCTAAATTCTATTCTTTTGCTTCTGAG
CCTCTGCAGTTTTCTATCTGTTGTAATAACTCAGTGAATGTAGTTGAGCCTAGAGGTTCTTGCAGTGTACAAATTTCACC
TGGAGCTCCAGAAATTACTCTCAACAGGTCCTCCAAGGTTGCAGCTATTGCTTCAATTGCCGAAGCTGAATGCAAGGAAG
ATACAGGCCTACAGCCCAGTCGCAAGCAACAAAGTGTTCGCAGGCGCTGCTTGACTTTTGACGTGGGAGGCTCTCACAAA
AAGATACCTTTGCGTGATTCTACGAACGATCTTCCTCTTCATTCTGCCTCTATCAGCAAAGCTCCTAGTCCACAAGAGTG
TTTAGAAACCAGCAAACAAGATACTGATGAGATTATACCCATACCACGAACTATTGGCCTGCACTTGAATTCTTTTGTGA
ACCCCTCAGTCTCTAGTGACCGCAAAAAAAAAAAAATCAATGATGATCGAGATTTAGGTTACAGTGATGTCAAAATCATG
GAGGCTCCTGAGAGATCAATGGAAGGAGAATCTTTTGACCAACACATGGCAACAAAAAATAGGAAATTGTCTCAAGGACT
TGACGAACTTGGTAGCTGTAAGCGCTGTAAATGTAGGAAATCCAAATGCTTGAAGCTGTATTGCGATTGTTTTGCTGCTG
GTCTATACTGTGTTGAACCTTGTTCATGTCAAAATTGTTTCAATAAGCCCATTCATGAAGACCTAGTTATAAAAGCTCGT
GAAGTGATTGAAGCTCGCAATCCATTAGCTTTCGCTCCAAAAGTGGTCTCGACCTCTGATTCTGCTATAGATTTATGGGA
CGAAAACAGCAAGACCCCTGCCTCAGCAAGACATACAAGAGGATGCAATTGCAGGAAATCAGGCTGCCTAAAGAAATATT
GTGAATGCTATATGATGGGCGTTGGATGCTCCTCGAACTGCAGATGCATGGGATGCAAGAATAATTTTATTCACAAAAAT
GAGAAATGTGAGGGAGAATCTGATGCGGTTACAATCAATGATGAAGCTAAAGATAATGATGATCATGCCGATGCTTCAAG
CCAAAATGAAGATGCCTCAAAGAGTGAGAGAAGGAACTGTGTGTTGCTCCAAAGTCCTGTAGCATTTCGTTCCTTAGCAT
CACTGCGAAAACTGTCTGAACTCTGA