Details for Capsella Locus Carubv10013224m

Position : scaf_3 ( 5`- 5769426 .. 5771895 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013224m

Protein [Map View]
MSSSTLLVNLTRLYVSCNKVEFARHVFDEIPHPRTNPIAWDVMIRAYASNGFSEEALDLYYKMLNSGVRPTKYTYPFVLK
ACAGLRAMEDGKLIHSHVTCSNFATDMYVCTALVDFYAKCGELDMALQVFDQMPKRDIVAWNAMISGFSLHCCLTDVIGL
FLNMRRIDGLRPNLSTIVGMFPALGRAGALREGKAVHGYCTRIGFSNDLVFETGILDVYAKSKCLIYARRVFDSVSLKNE
VTWSAMIGGYIENEKVTEAGEVFVQMLVNADVAMVTPVAIGLILMGCARFGDLNGGQCVHCYAVKAGFILDLTVGNTIIS
FYAKYGSLSDAFKQFGEIGLKDVVSYNSLISGCVENCRSEESLCLFHDMKSSGMKPDITTLLGVLTACSHLAALGHASSC
HGYCVVHGYAANTRICNALMDVYTKCGKLDLAKRVFDTMQNRDIVSWNTVLFGFGIHGLGKEALSLFNSMHDTGVYPDEV
TFLAILSACGHSGLVDEGKQLFNSMSSGDYNVIPRIDHYICMTDLLTRAGYLDEAYDFVNKMPFEPDIHVLGTLLSACWT
YNNVELGEKVSKKMQSLGGTTESLVVLSNTYSAAERWEDAANTRMTQKKRGLHKSPGFSWVDV*

DNA
ATGAGTTCATCTACCCTGCTCGTCAATTTAACGCGTCTTTACGTATCATGCAACAAAGTGGAATTTGCACGCCATGTGTT
CGATGAAATTCCTCATCCAAGGACGAATCCTATTGCGTGGGACGTGATGATCAGAGCCTACGCGTCGAATGGTTTCTCGG
AAGAAGCTTTGGATTTGTACTACAAGATGCTCAATTCTGGTGTTCGACCCACGAAATATACCTACCCATTTGTGTTGAAA
GCATGTGCTGGTCTGCGAGCCATGGAAGATGGTAAGCTGATACATAGCCATGTGACATGTAGCAACTTTGCAACTGATAT
GTATGTCTGTACTGCTCTGGTTGATTTTTATGCTAAATGCGGGGAACTAGATATGGCATTACAAGTGTTCGACCAAATGC
CTAAAAGAGATATTGTGGCATGGAACGCTATGATTTCTGGGTTTTCTTTACATTGCTGTTTAACTGATGTCATTGGATTG
TTTTTGAATATGCGTAGAATCGATGGACTCAGGCCTAATTTATCCACAATCGTTGGGATGTTTCCTGCTCTAGGAAGAGC
TGGTGCTTTGAGGGAAGGGAAAGCTGTTCATGGGTATTGCACACGGATTGGTTTTAGCAATGATTTAGTTTTTGAGACGG
GGATCTTGGATGTATATGCCAAAAGCAAGTGCCTTATCTATGCGAGGAGAGTTTTCGATTCAGTCTCTTTAAAGAATGAG
GTAACCTGGAGTGCTATGATTGGAGGCTACATAGAAAATGAAAAGGTCACGGAAGCTGGAGAAGTGTTTGTGCAGATGCT
GGTTAATGCAGATGTGGCGATGGTGACACCAGTGGCCATTGGGCTTATTCTTATGGGTTGTGCGAGATTTGGAGATCTGA
ATGGAGGGCAATGCGTACATTGTTACGCGGTGAAAGCAGGCTTCATCTTAGACTTAACTGTTGGAAACACCATTATTTCA
TTTTACGCCAAGTATGGAAGCTTATCTGATGCTTTTAAACAGTTTGGTGAGATTGGCTTGAAAGACGTTGTTTCATATAA
TTCTCTAATCTCTGGGTGTGTGGAGAACTGTCGCTCAGAAGAGAGTTTATGTCTATTTCATGATATGAAATCCTCTGGAA
TGAAGCCAGATATAACAACGCTGCTTGGTGTCTTAACCGCTTGCTCTCACTTGGCTGCTTTGGGACACGCTTCTAGTTGT
CACGGGTATTGTGTTGTTCATGGCTATGCAGCTAATACAAGGATTTGTAATGCACTGATGGATGTGTACACAAAGTGTGG
AAAACTTGATTTAGCCAAGAGAGTTTTCGACACAATGCAGAACCGGGATATAGTTTCCTGGAACACAGTGCTGTTTGGAT
TTGGAATTCATGGGCTTGGCAAAGAAGCTCTTTCTCTGTTCAACAGTATGCATGACACAGGTGTGTACCCAGACGAGGTG
ACTTTTCTTGCTATTTTGTCTGCTTGTGGCCATTCAGGGCTTGTGGATGAAGGGAAACAACTGTTCAACTCCATGTCTTC
AGGAGATTACAACGTCATCCCAAGAATAGACCATTACATTTGCATGACTGACCTTCTAACTCGTGCCGGATACTTGGATG
AAGCTTATGATTTTGTCAACAAGATGCCATTTGAGCCAGACATTCATGTTTTGGGTACACTTCTCTCTGCTTGTTGGACC
TACAATAATGTGGAACTTGGGGAAAAAGTGTCGAAAAAGATGCAGAGTCTTGGTGGAACAACAGAAAGCCTAGTAGTTCT
ATCCAACACCTACTCAGCTGCTGAGAGATGGGAAGATGCAGCAAATACTAGAATGACACAAAAGAAAAGAGGGCTTCATA
AGTCCCCAGGTTTCAGCTGGGTCGATGTTTGA