Details for Capsella Locus Carubv10013221m

Position : scaf_3 ( 5`- 6907831 .. 6913030 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013221m

Protein [Map View]
VITFAGRPVILSLSFFFFFFFFIFTTSISPSLSLFLWCFFFFPYQTLWCSPMAVFPIGSHFAPPHQLTKRHAIATSSPIS
ISTRLPQNVSFSKVSASRLSRHSVLVRAEDKIRTSSSPPSLDDEPIDEDLMDSGSCDPICSVDEPSSSYFEANYQPKTDI
IKALAILAAALTGTAAINHSWVAANQDIAMALLFGIGYAGIIFEESLAFNKSGIGLLMAVSLWVVRSIGAPSTEIAVLDL
QHATAEVSEIVFFLLGAMTIVEIVDAHQGFKLVTDNITTRKPKTLLWVVGFVTFFLSSILDNLTSTIVMVSLLRKLVPQS
EYRKLLGAVVVIAANAGGAWTPIGDVTTTMLWIHGQISTLPTMQDLFIPSAVSLAVPLALLSLTSEVNGKEQDSKDVLAS
EKMAPRGKLVFGVGLGALVFVPVFKALTGLPPYMGILLGLGVLWILTDAIHYGESERQKLKVPQALSRIDTQGALFFLGI
LLSVSSLEAAGILREIANYLDANIPNVELIASAIGVVSAIIDNVPLVAATMGMYDLTSFPQDSEFWQLIAFCAGTGGSML
VIGSAAGVAFMGMEKVDFFWYFRKVSGFAFAGYAAGIAAYLAVHNLHLSIPTTVAQIPFLPGS*

DNA
GTCATTACTTTCGCCGGACGGCCGGTGATTCTATCACTTTCTTTCTTCTTCTTCTTCTTCTTCTTCATCTTCACTACTTC
AATCTCCCCTTCTCTCTCTCTCTTTCTCTGGTGTTTTTTTTTCTTTCCCTATCAGACTCTCTGGTGTTCGCCAATGGCGG
TGTTTCCTATCGGCTCTCACTTCGCGCCGCCGCATCAGTTGACGAAGAGACACGCCATCGCGACTTCATCTCCTATCTCT
ATCTCGACCCGATTGCCGCAGAATGTCTCCTTCTCGAAAGTATCAGCCTCGAGGTTATCCAGACATAGCGTTCTCGTGAG
GGCCGAGGATAAGATAAGGACCTCTTCTTCTCCTCCTTCGCTTGATGATGAGCCAATCGATGAGGATTTAATGGATTCAG
GATCATGTGACCCTATATGCTCGGTTGATGAACCTAGTTCGAGTTACTTTGAGGCCAATTACCAACCAAAGACAGATATA
ATCAAAGCGCTTGCTATTCTTGCTGCTGCTCTTACAGGAACAGCTGCCATTAACCATTCATGGGTTGCTGCTAATCAGGA
TATTGCTATGGCATTGTTGTTTGGAATAGGATATGCCGGAATCATCTTTGAAGAGTCTTTAGCTTTTAATAAAAGTGGAA
TAGGACTGCTGATGGCTGTGAGTTTGTGGGTTGTGCGGAGCATAGGGGCTCCTTCAACTGAGATAGCTGTTTTAGATCTT
CAACATGCAACAGCTGAAGTTAGTGAAATAGTATTTTTCTTGCTTGGCGCAATGACCATTGTGGAGATAGTTGATGCTCA
CCAAGGGTTTAAGTTGGTTACAGACAATATCACCACTAGGAAGCCAAAGACACTTTTATGGGTGGTTGGCTTTGTGACAT
TTTTCCTCAGTTCGATTTTAGACAATTTGACCTCTACCATTGTCATGGTTTCTTTATTGAGGAAACTGGTTCCTCAATCA
GAATACCGCAAACTTCTAGGAGCTGTTGTGGTAATAGCAGCAAATGCAGGAGGAGCATGGACTCCAATTGGTGATGTTAC
TACAACGATGTTATGGATTCATGGTCAGATATCCACCTTACCGACTATGCAGGACCTTTTTATACCTTCTGCCGTTTCTC
TTGCGGTTCCTCTAGCCCTCTTGTCCTTAACCAGTGAGGTAAATGGAAAGGAACAGGATTCTAAAGATGTATTGGCTTCT
GAAAAGATGGCTCCAAGAGGAAAACTAGTTTTTGGAGTTGGCCTTGGAGCATTGGTATTTGTTCCCGTCTTTAAGGCTCT
TACTGGATTGCCTCCTTACATGGGTATCTTGTTGGGTCTTGGAGTTCTTTGGATTTTGACGGATGCCATTCATTACGGTG
AATCAGAAAGACAAAAGCTCAAAGTACCTCAGGCCTTATCTCGAATTGACACACAAGGCGCTCTCTTTTTCCTGGGGATT
CTTTTATCTGTTAGCAGCCTTGAGGCAGCTGGGATCCTCCGGGAGATTGCAAACTACCTTGATGCTAATATACCAAATGT
TGAGCTAATCGCAAGTGCTATTGGTGTTGTATCAGCAATCATAGACAATGTTCCATTGGTTGCAGCGACCATGGGGATGT
ATGATCTGACATCATTCCCTCAAGATTCTGAATTTTGGCAGCTTATAGCATTCTGCGCCGGCACTGGTGGTTCCATGCTT
GTCATCGGTTCTGCTGCTGGTGTAGCCTTCATGGGGATGGAGAAAGTTGATTTCTTCTGGTACTTCCGAAAGGTTAGTGG
TTTTGCTTTTGCTGGTTATGCTGCTGGTATTGCGGCTTACCTTGCAGTTCATAATCTTCATTTGTCCATCCCGACAACGG
TGGCTCAGATCCCATTTCTCCCTGGTTCATAA