Details for Capsella Locus Carubv10013219m

Position : scaf_3 ( 5`- 3751518 .. 3755289 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013219m

Protein [Map View]
MSRQKQSVENLLLLGKIRKRGCSSPTSSTSSILREGYRFKRAIVVGKRGGSTTPVPTWRLMGRSPSPASVSRASGALHTA
ASPSHCGSKSGKVPAAAPVSARKLAATFWEMNEMPSPRVVEAAVPIIRKSRKERIAPLPPPRSSVHSGSLPPHLSDPSHS
PVSERMERSGTGSRQRRPSSTVQKLRLGDCNVGARDPISNGSFMDIETRSRVETPTGSTVGVKTRLKDCSNALTTSKELL
KIINRMWGQDDRPSSSMSLVSALHSELERARLQVNQLIHEHKPENNDISYLMKRFAEEKAAWKSNEQEVVEAAIESVAGE
LEVERKLRRRFESLNKKLGKELAETKSALMKAVKEIENEKRARVMVEKVCDELARDISEDKAEVEELKRESFKVKEEVEK
EREMLQLADALREERVQMKLSEAKHQLEEKNAAVDKLRNQLQTYLKAKRCKEKTREPPHTQLHNEETGEYLNHHIGFGSY
NIEDGEVEDGNEDDSGESDLHSIELNIDNKSYKWPYGEENRGRKATPRKSLSLQRSISDCVDWVVQSEKLQKSGDGGLDW
GRSIEVEPKGYLDETQAYKPNKASSKDHHLVSGSRLSNFRGGSVSKSRLSDAAKGENQNARKSRW*

DNA
ATGTCGAGGCAGAAACAAAGCGTAGAGAATCTACTTCTCTTAGGAAAAATTAGGAAACGTGGATGTTCTTCGCCGACGTC
GTCCACTTCTTCGATTCTCCGGGAAGGTTACAGGTTCAAAAGAGCGATTGTTGTTGGTAAAAGAGGAGGATCCACTACTC
CTGTTCCTACATGGCGACTCATGGGCCGATCTCCGTCTCCAGCTTCCGTTTCGCGAGCTTCCGGTGCTTTACACACCGCT
GCGTCTCCGTCGCACTGCGGGAGCAAATCCGGTAAAGTTCCAGCTGCTGCTCCTGTTTCGGCTAGGAAGCTTGCGGCGAC
GTTTTGGGAGATGAACGAGATGCCTTCGCCGAGAGTGGTGGAGGCGGCTGTGCCAATTATTAGAAAGAGTAGAAAGGAGA
GAATCGCGCCGCTTCCTCCGCCGAGGTCGTCGGTTCATTCTGGTTCCCTACCGCCTCATCTGTCTGATCCTTCGCATAGT
CCAGTCTCTGAGAGGATGGAAAGATCAGGGACTGGAAGTCGCCAGAGAAGACCATCATCAACTGTGCAGAAGCTTAGGCT
TGGAGACTGCAATGTGGGGGCTAGGGATCCTATTAGCAATGGCAGCTTCATGGATATTGAGACTCGATCACGGGTGGAGA
CACCGACTGGTTCAACTGTGGGAGTCAAAACACGGTTGAAGGATTGTAGTAACGCTCTCACTACATCAAAAGAGCTTCTC
AAAATCATTAATAGAATGTGGGGTCAAGATGACCGCCCATCTTCTAGCATGTCCCTCGTCTCTGCTTTACATTCTGAGCT
TGAAAGAGCTCGCTTACAAGTCAATCAGTTAATCCATGAACATAAACCGGAAAACAATGACATCAGCTACTTGATGAAGC
GTTTTGCTGAGGAGAAAGCAGCGTGGAAAAGCAATGAGCAAGAAGTTGTTGAGGCTGCAATCGAATCTGTGGCTGGTGAA
CTAGAAGTGGAGAGGAAGCTGAGGAGAAGGTTTGAGAGCTTGAACAAGAAATTAGGCAAAGAATTGGCTGAAACAAAATC
AGCTCTGATGAAAGCAGTGAAAGAAATCGAGAACGAGAAGCGAGCGAGAGTGATGGTTGAGAAAGTTTGTGATGAACTAG
CAAGAGACATAAGCGAAGACAAAGCCGAAGTTGAAGAACTGAAGAGAGAATCTTTTAAAGTCAAAGAAGAAGTCGAAAAG
GAAAGAGAGATGTTGCAGTTAGCAGATGCATTGCGGGAAGAAAGAGTGCAAATGAAACTCTCAGAAGCTAAGCATCAGCT
CGAGGAGAAAAATGCAGCTGTTGATAAGCTAAGGAATCAGCTTCAAACCTACCTCAAAGCGAAAAGATGCAAAGAGAAGA
CCCGTGAACCGCCTCATACTCAGCTACATAACGAAGAGACAGGAGAGTACTTGAACCACCACATCGGTTTTGGTTCATAT
AACATCGAAGACGGAGAGGTCGAGGATGGAAATGAAGATGATTCAGGAGAAAGCGATCTTCATTCCATAGAACTGAACAT
TGACAACAAGAGCTATAAATGGCCTTATGGTGAAGAGAACAGAGGGAGGAAAGCAACGCCAAGGAAAAGCCTTTCTCTAC
AAAGAAGCATATCGGATTGTGTTGATTGGGTTGTACAGAGCGAGAAGCTTCAAAAGAGTGGAGATGGAGGATTGGATTGG
GGAAGGTCTATTGAGGTTGAGCCTAAAGGGTATTTAGATGAAACGCAAGCTTATAAACCAAACAAGGCTTCTTCAAAAGA
TCATCATCTGGTCTCAGGTTCGAGGCTAAGTAACTTCCGCGGTGGATCCGTTTCGAAGTCGCGGTTATCTGATGCCGCGA
AAGGAGAAAACCAGAATGCTAGAAAATCAAGATGGTAA