Details for Capsella Locus Carubv10013217m

Position : scaf_3 ( 5`- 3189609 .. 3198899 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013217m

Protein [Map View]
MLVYAKGFLKCGAPGVPFFFDKRNSFLTNTKRGFHSLPSGTGDCVYFNNNLRYSTKSIEVVEKAAIEMGSKEAKAENPAL
SSYDDAMEALSTLISRRNRGDRTPTSGSRDKLEQVIAYLKILDLEDKIQELKVIHVAGTKGKGSTCVFSEAILRNCGFRT
GMFTSPHLIDVRERFRIDGLDISEEKFLQYFWECWKLLKEKAVDGLTMPPLFQFLTVLAFKIFVCEKVDVAVIEVGLGGK
LDSTNVIRKPVVCGIASLGMDHMDILGNTLADIAFHKAGIFKPQIPAFTVPQLSEAMEVLQKTANNLEVPLEVVAPLDLK
MLDGVALGLSGDHQLVNAGLAVSLSRCWLQRTGNLEKIFPNGTKETEIPVAFCRGLATARLHGRAQVVHDVVSDPQDSSG
STESSCGDLIFYLDGAHSPESMDACGRWFSAAVTGNKSLSTAVNGYRRNGEYSRDFHRVSRQILLFNCMEVRDPQVLLPK
LVTTCASSGTHFSRALFVPSMSTYNKVISGAAAIPSDTRRKDLTWQFRLQRLWEKSIQGTDAALDHTLKPDGITTLPPHD
FLCGDAPHCGGPAGTQVVTSSAVMPSLPLTINWLRDCVRRNPSLKLEVLVTGSLHLVGDVLRLLKR*

DNA
ATGCTCGTTTATGCGAAAGGGTTTCTAAAGTGCGGAGCACCTGGAGTTCCATTCTTTTTTGACAAAAGAAATTCCTTCTT
AACTAATACAAAGAGGGGCTTTCACAGTTTACCCTCAGGCACTGGAGATTGTGTTTATTTCAACAATAATCTTAGGTACT
CAACCAAATCAATAGAAGTTGTGGAGAAAGCTGCCATTGAGATGGGTTCAAAGGAAGCAAAGGCAGAGAATCCAGCTTTA
TCTTCATACGATGATGCCATGGAAGCGCTGTCAACTCTTATTTCTCGTCGAAACCGTGGGGACCGCACACCTACTAGTGG
AAGTCGTGACAAGCTTGAACAAGTCATCGCATATCTCAAGATTTTGGACCTGGAGGACAAAATACAAGAACTAAAAGTTA
TTCATGTTGCAGGAACTAAAGGAAAGGGTTCAACATGTGTCTTCAGTGAGGCAATTTTACGTAATTGTGGGTTTCGAACC
GGAATGTTTACATCTCCACACCTGATTGATGTAAGGGAAAGATTTCGAATAGATGGCTTGGATATATCTGAGGAAAAGTT
TCTACAGTATTTCTGGGAATGTTGGAAGTTACTGAAGGAGAAAGCAGTAGATGGTCTTACCATGCCTCCTCTTTTTCAGT
TCCTCACAGTATTGGCGTTTAAGATTTTTGTTTGTGAAAAGGTTGATGTTGCTGTCATTGAAGTTGGACTTGGGGGAAAA
CTTGACTCGACAAATGTGATTCGAAAACCTGTCGTCTGCGGCATTGCATCTCTTGGGATGGATCATATGGATATATTGGG
AAATACGCTAGCTGATATTGCATTTCATAAGGCTGGGATTTTCAAGCCTCAAATCCCCGCCTTCACAGTACCCCAACTCT
CTGAAGCAATGGAGGTTCTTCAGAAAACAGCTAATAATCTTGAGGTTCCTCTGGAAGTGGTAGCCCCTCTTGACCTTAAA
ATGTTGGACGGAGTTGCGCTTGGCTTGTCTGGGGATCATCAGCTTGTAAATGCAGGTCTCGCTGTTTCTCTTTCAAGATG
CTGGCTTCAGAGAACTGGGAATTTGGAGAAGATATTTCCAAATGGAACCAAGGAAACTGAGATTCCCGTGGCATTTTGTC
GTGGTCTTGCAACGGCACGTCTTCATGGGAGAGCTCAAGTTGTTCATGATGTAGTTTCAGATCCACAGGACTCGTCTGGT
TCCACGGAATCTTCATGCGGTGATCTGATATTTTACTTGGATGGAGCTCACAGTCCAGAGAGCATGGATGCTTGTGGTCG
ATGGTTCTCTGCTGCAGTCACAGGAAACAAAAGCTTGTCTACTGCTGTCAATGGTTACAGGAGAAATGGGGAGTATAGTA
GAGACTTTCACAGAGTCTCCAGACAGATTCTTCTGTTCAACTGCATGGAAGTAAGAGACCCTCAAGTCTTACTTCCAAAG
CTCGTCACCACTTGCGCTTCCTCAGGCACTCATTTCTCAAGAGCGCTTTTTGTCCCGAGCATGTCTACTTACAACAAGGT
CATTTCGGGTGCAGCAGCGATTCCTTCGGATACACGTAGAAAAGATTTGACTTGGCAGTTCAGACTACAAAGACTGTGGG
AGAAATCAATCCAAGGAACAGATGCTGCGCTTGACCATACACTGAAACCGGATGGAATAACCACCTTACCACCTCATGAT
TTCCTATGTGGAGATGCACCTCATTGTGGTGGACCTGCAGGGACACAAGTGGTCACTTCCAGCGCTGTAATGCCTTCATT
GCCATTGACTATAAACTGGCTACGAGACTGTGTACGACGGAACCCTTCACTGAAACTAGAGGTTCTGGTCACAGGATCGT
TACATCTTGTTGGAGATGTGCTCAGATTGCTGAAGAGATGA