Details for Capsella Locus Carubv10013207m

Position : scaf_3 ( 5`- 6587167 .. 6590549 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013207m

Protein [Map View]
MSSSHNRSNNNNSEGAKAEQIIFEFFAKSLHIILESRTPFMSSRNFSGDQMICSPSSSSSSSSSVRPRDKWFNLALRECP
AALESFDIGRRSSLEPLVVDVVLVVRPLVGDQMNLSAKRELIRNFSEKEYQSGWNSDQDELGCETKNEQIIERWVVQYDN
RKIRESVTTSSRRSSSSNKLQLMYKKATLLLRSLFVMVRLLPAYKIFRELNSSGQIFKFKLVPRVPSIVEPFTRREEAEM
QKFSFTPVETICGRLCLSVLYRSLSDVSCEHSTPMSPTFITDYVGSPLADPLKRFPSLPLSYGSPPLLPFQRRHSWSFDR
HKASPPSVSCSPSPTRSDSHALVSHPCTRHLPPHPSEIPTGRRKESYPEEYSAYQDFSPPLSPSAPIQAVPRGITRTESA
PVRIPAPTFQSKQNIVAPNPHLKLSRHASLKPVRNFGPGESGPAVDKLFLYGRDDFRKHSGVRPSSNSSPGISFSRSSSR
SFQEDFDDPDFPCPFDVEYDDITDRSSRPGSFDHRGDMHEPLESSGSFPKKSQDAAVGALVKMLKKAPPLRQDVSESSIP
EICWNNNNKPARAQEIAVASITASGLALTSKTTADALEELRSYKEMKNHLLLSQSTSNPSSVTTSPFDV*

DNA
ATGTCATCTTCACACAACAGGAGTAACAACAACAATTCAGAAGGTGCTAAAGCAGAACAGATCATATTTGAGTTCTTTGC
TAAAAGCCTTCACATTATTCTTGAATCAAGGACTCCTTTTATGTCTTCGAGGAATTTTAGTGGTGACCAGATGATTTGTT
CCCCTTCCTCTTCTTCTTCCTCTTCCTCCAGTGTCAGGCCTCGGGACAAATGGTTCAATCTTGCCCTTAGGGAATGTCCT
GCGGCGCTGGAGAGTTTTGATATCGGGCGCAGAAGCAGTCTTGAGCCTTTGGTTGTTGATGTCGTTCTTGTGGTGAGGCC
ACTTGTTGGTGATCAGATGAACTTGTCTGCTAAAAGGGAGCTTATCAGGAACTTTTCCGAGAAAGAGTACCAGTCGGGTT
GGAATTCTGATCAAGATGAATTGGGATGTGAAACTAAGAACGAGCAGATAATTGAGAGATGGGTGGTGCAGTATGATAAT
AGGAAGATCAGGGAATCTGTTACTACCAGCAGCAGGAGGTCAAGTAGTAGTAATAAGTTGCAACTGATGTATAAGAAGGC
AACTCTGCTGCTTAGGTCATTGTTTGTGATGGTTAGGCTTTTGCCTGCTTATAAGATTTTCCGGGAACTCAATTCCTCTG
GGCAGATCTTCAAGTTCAAGCTTGTTCCTAGGGTCCCTTCTATTGTTGAGCCATTCACTCGCAGAGAAGAGGCAGAAATG
CAGAAGTTTTCTTTCACACCTGTTGAGACTATATGTGGTAGACTTTGCTTGTCGGTTCTATATCGTTCTCTCTCAGATGT
CAGTTGCGAACACTCGACTCCTATGTCTCCAACATTTATAACCGATTATGTTGGAAGTCCCCTGGCTGATCCTTTAAAGA
GGTTCCCTTCCCTTCCTCTTTCATATGGCTCACCTCCCTTGTTGCCATTTCAAAGGCGCCATAGCTGGAGTTTTGATCGT
CACAAGGCGTCTCCACCTTCTGTTTCTTGCTCACCATCGCCTACACGCTCAGATTCACATGCATTGGTTTCACATCCCTG
TACCCGTCACCTTCCTCCTCACCCTTCTGAGATACCCACGGGTCGAAGGAAAGAAAGCTACCCTGAAGAGTATTCTGCTT
ATCAAGATTTCTCCCCTCCTCTTTCTCCTTCAGCACCAATACAGGCTGTCCCACGAGGCATCACACGTACTGAAAGTGCT
CCAGTGAGAATCCCAGCTCCGACTTTCCAGTCCAAACAAAACATTGTGGCACCTAACCCTCATCTAAAATTGTCGAGACA
CGCCTCTTTAAAGCCTGTGAGAAACTTTGGTCCTGGTGAATCTGGACCAGCAGTAGACAAGCTGTTTCTTTATGGGAGAG
ATGACTTTAGAAAGCATTCTGGGGTGAGGCCGTCTTCCAACAGCTCACCGGGGATATCATTTTCCCGGAGTTCTAGTAGA
TCTTTCCAAGAAGATTTTGATGATCCTGATTTCCCTTGCCCATTTGATGTTGAGTATGATGATATTACAGATCGTAGTAG
CAGACCAGGGTCGTTCGACCACAGAGGAGACATGCATGAGCCACTCGAGTCAAGCGGTTCATTCCCTAAAAAGTCCCAAG
ATGCTGCAGTTGGTGCCCTTGTGAAAATGCTGAAAAAAGCTCCACCTCTCAGACAAGATGTCTCCGAATCTTCCATTCCT
GAAATTTGTTGGAACAACAACAACAAACCTGCACGGGCTCAGGAGATAGCAGTAGCGTCAATCACAGCCTCGGGGCTTGC
TTTGACCTCAAAGACAACAGCTGATGCTTTGGAAGAGTTGAGGTCCTACAAAGAAATGAAGAATCATTTGTTGCTTAGTC
AATCCACATCAAACCCTTCCTCGGTTACCACTTCACCCTTTGATGTTTGA