Details for Capsella Locus Carubv10013187m

Position : scaf_3 ( 5`- 2250764 .. 2254947 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10013187m

Protein [Map View]
MPEISPADLSRLSSPSSSSSSSSSGRASVQIEEIEGGAVGAIGGASGVVIGSEELETNPKTLADNTVAESSGSGNKSFSR
VWTMPVEGSSSSERGEPSSTATTTKQPRLQKSKTERQQKVTHILAEDAAKIFDDKISAGKKLKLLNRIATVKHDGTVEFD
VPADAIPQPIVVDREGSKNGFCADESIDGIDLQYIPPMQIVMLIVGTRGDVQPFVAIAKRLQDYGHRVRLATHANFKEFV
LTAGLEFYPLGGDPKVLAGYMVKNKGFLPSGPSEIPIQRNQMKDIIYSLLPACKEPDPDSGISFKADAIIANPPAYGHTH
VAEALKIPIHVFFTMPWTPTSEFPHPLSRVKQPAGYRLSYQIVDSLIWLGIRDMVNDLRKKKLKLRPVTYLSGTQGSGSN
IPHGYMWSPHLVPKPKDWGPQIDVVGFCFLDLASNYEPPAELVEWLEAGDKPIYIGFGSLPVQEPEKMTEIIVEALQRTK
QRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVVHHGGAGTTAAGLKASCPTTIVPFFGDQPFWGERVHARGV
GPAPIPVDEFSLHKLEDAINYMLDEKVKSNAETLAKAMKDEDGVAGAVKAFFKHLPSTKQNLPDPVPEAPGFLSFRRCFG
LS*

DNA
ATGCCGGAAATTTCGCCGGCTGACCTCTCCAGGCTTTCTTCCCCTTCTTCTTCTTCTTCTTCCTCAAGTTCCGGCCGAGC
CTCTGTTCAAATCGAGGAGATTGAAGGCGGAGCTGTCGGTGCTATTGGTGGTGCCAGTGGCGTCGTCATTGGCTCCGAAG
AACTTGAGACCAATCCGAAAACTCTTGCTGATAACACCGTTGCTGAATCTTCAGGTTCTGGGAATAAAAGCTTTTCACGA
GTATGGACAATGCCAGTGGAGGGTTCATCGAGCAGTGAAAGGGGTGAACCGTCATCAACAGCAACAACAACAAAACAACC
TAGGTTACAAAAATCAAAGACTGAGAGGCAGCAAAAAGTTACTCACATTCTTGCTGAGGATGCTGCTAAGATCTTCGATG
ACAAAATCTCTGCTGGCAAGAAGCTTAAATTGCTGAACCGTATAGCTACTGTGAAACATGATGGTACTGTTGAGTTTGAT
GTTCCAGCAGATGCTATCCCCCAACCTATTGTTGTTGACCGTGAAGGATCCAAAAACGGTTTTTGTGCTGATGAGTCTAT
TGATGGGATAGACCTTCAGTATATCCCTCCTATGCAAATCGTTATGCTCATTGTTGGAACACGCGGTGATGTTCAACCTT
TTGTTGCAATAGCCAAACGCCTTCAGGACTATGGGCATCGAGTTAGACTTGCAACTCATGCAAATTTTAAAGAGTTTGTT
TTGACTGCTGGACTGGAGTTCTATCCTCTAGGTGGAGATCCAAAAGTGCTTGCCGGTTATATGGTTAAGAACAAGGGCTT
TTTACCATCAGGCCCTTCAGAGATCCCAATTCAACGAAACCAAATGAAAGACATCATATATTCTCTACTTCCAGCATGTA
AAGAACCTGATCCAGATTCTGGGATTTCCTTTAAAGCTGATGCCATCATTGCCAACCCCCCAGCGTATGGACATACACAT
GTGGCAGAAGCACTGAAGATACCGATTCACGTGTTTTTCACCATGCCATGGACACCAACCAGTGAATTTCCACACCCATT
GTCACGTGTCAAACAACCAGCAGGATACAGACTTTCGTATCAAATCGTCGACTCATTGATCTGGCTTGGTATAAGAGATA
TGGTGAATGACCTTAGGAAAAAGAAATTGAAACTACGGCCTGTTACATATCTAAGTGGAACACAAGGATCTGGATCTAAT
ATCCCACATGGATATATGTGGAGTCCTCACCTCGTCCCAAAGCCAAAAGACTGGGGGCCTCAAATTGATGTAGTGGGATT
TTGCTTTCTTGATCTTGCGTCCAACTATGAACCTCCTGCAGAGCTTGTGGAATGGCTAGAAGCTGGTGACAAGCCCATAT
ATATCGGCTTCGGTAGTCTCCCTGTTCAAGAACCAGAGAAAATGACAGAAATCATTGTGGAAGCACTCCAAAGAACTAAA
CAGAGAGGAATCATCAACAAAGGCTGGGGTGGCCTTGGAAACTTGAAAGAACCAAAGGACTTCGTTTACTTGTTGGATAA
TGTCCCACATGACTGGCTATTCCCGAGATGCAAGGCTGTGGTTCATCATGGTGGTGCTGGAACAACTGCTGCAGGTCTTA
AAGCCTCGTGCCCAACTACAATCGTGCCTTTCTTTGGAGACCAACCTTTTTGGGGAGAACGAGTGCATGCTAGAGGTGTA
GGTCCTGCACCAATCCCAGTGGATGAATTCTCACTTCATAAGCTTGAAGATGCCATAAATTATATGCTCGATGAAAAGGT
GAAGAGCAATGCAGAGACGCTAGCAAAGGCGATGAAGGACGAGGATGGTGTGGCTGGAGCCGTAAAGGCCTTCTTTAAAC
ATCTTCCAAGTACGAAACAGAATCTTCCGGATCCAGTCCCTGAAGCTCCTGGATTTCTCTCTTTTAGAAGATGCTTTGGA
TTGTCTTGA